KEGG   Vulpes vulpes (red fox): 112915770
Entry
112915770         CDS       T05911                                 

Gene name
SESN3
Definition
(RefSeq) sestrin-3 isoform X1
  KO
K10141  sestrin 1/3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112915770 (SESN3)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    112915770 (SESN3)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 112915770
NCBI-ProteinID: XP_025849045
UniProt: A0A3Q7T2G8
LinkDB
Position
Unknown
AA seq 483 aa
MRCLGPQPSTAESEILEDKRILVSQPLTRGPSAFIPEKEVVQANTVDERTNFLVEEYSTS
GRLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPHRHYIAIMAAARHQCSYLINMHV
DEFLKTGGIAEWLNGLEYVPQRLKNLNEINKLLAHRPWLITKEHIQKLVKTGENNWSLPE
LVHAVVLLAHYHALASFVFGSGINPERDPEISNGFRLISVNNFCVCDLANDNNIENASLT
GSNFGIVDSLSELEALMDRMKRLQGEREDEEASQEEMTTRFEKEKKESLFVVSGDTFHSF
PHSDFEDDMIITSDVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHGFSLVNRLYS
DIGHLLDEKFRMVYNLTYNTMAAHEDVDTTTLRRALFNYVHCMFGIRYDDYDYGEVNQLL
ERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITR
HLT
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgcgctgtttggggccccaacccagcactgctgaatcagaaattttggaggataaaaga
atcctagtatctcaacctttgacaagaggaccaagtgcctttattccagagaaggaagtt
gtccaagcaaacacagtggatgaacgtactaactttcttgtggaagaatactctacatcc
ggtcggctggacaacatcacccaggtcatgagtctccacactcagtacctggagtcgttc
ctgcggagccagttctacatgctgcgcatggacggcccccttcctctaccacacaggcac
tacattgcaataatggctgcggctagacatcagtgttcctacctaataaacatgcatgtg
gatgaatttttgaagacaggaggtattgctgagtggttgaatggtttggaatatgtacca
caaagactgaaaaatcttaatgaaataaacaagctgctagctcaccgaccctggctgatc
acgaaagagcacattcagaaacttgtcaaaactggagaaaataattggtctctgcccgaa
ctggtacatgctgtggtcctactggcacattatcatgctttggcaagctttgtttttggt
agtggcatcaatccagagagggatccagaaatctccaatggattcaggctaatatcagtc
aacaatttctgtgtttgtgatctcgctaatgataacaatatagagaatgcatcccttaca
ggcagcaactttgggattgtcgattctctaagtgagctagaggccttaatggacagaatg
aagaggcttcagggagagagggaagatgaagaggcatctcaggaagaaatgaccactcgc
tttgagaaggagaagaaagaaagtctttttgtggtctctggagacacttttcattcattt
cctcattcagattttgaagatgacatgattataacatctgacgtctctcgatatatcgaa
gaccctggttttgggtatgaggactttgccagacgaggagaagaacatttgccaacattc
cgagctcaggactatacctgggaaaatcacgggttctccctggtgaacagactttattct
gacattggacatcttcttgatgagaagtttcgcatggtctacaatctcacctataacact
atggccgcccatgaggatgttgacacaaccacgctgcgcagagctttatttaactatgtt
cactgtatgtttggaatcaggtatgatgactatgattacggagaagttaatcaattactt
gaacgaagcctgaaggtttacattaagacagtgacctgctatcctgaaagaaccaccaag
cgcatgtatgatagttactggcgtcagttcaagcactcagaaaaggttcatgtaaatcta
cttttaatggaagcacggatgcaagctgaactcctttatgcccttcgtgccataactcgg
catttgacctga

KEGG   Vulpes vulpes (red fox): 112925157
Entry
112925157         CDS       T05911                                 

Gene name
SESN1
Definition
(RefSeq) sestrin-1 isoform X1
  KO
K10141  sestrin 1/3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112925157 (SESN1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    112925157 (SESN1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 112925157
NCBI-ProteinID: XP_025861566
UniProt: A0A3Q7SZV4
LinkDB
Position
Unknown
AA seq 544 aa
MAEGDSEVRWDGLCSRDPSTRETALDSIRQTVLRRTEGLRPPDGLPPPAVSLDGLNRLLA
HLLMLSKRCPFKDVREKSEFILKSVQELGIRIPRPLGHGPSRFIPEKEILQVGSEDAQMH
TLFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARH
QCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLK
AEEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITN
GNHSMDEMQVNSAGNVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASRFEIEKRES
MFVFSSDDEEVTPARDVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCWEDHGYSLVNRLY
PDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQL
LDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAIT
RYMT
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggctgaaggagacagtgaagtgagatgggacgggctgtgcagtagggacccgagcact
agagagaccgcgctggacagcatcaggcagacggtcctgagaagaaccgagggtcttcgt
cccccagacgggctcccacccccggcggtttctttggatgggttgaatagactccttgct
cacctgctcatgctctctaagagatgtccctttaaagatgtaagagagaaaagtgaattt
attttgaagagcgtccaggaacttggaattagaattcctcgaccactaggacacggacca
agcagattcataccagaaaaggagattctccaagtggggagtgaagacgcacagatgcac
accttatttgcagattcttttgctgctttgggtcgtttggataacattacattagtgatg
gtttttcacccacaatatctagaaagttttctaaaaactcaacactatctactgcaaatg
gatgggccattacctttacattatcggcactacatcggaattatggctgcagcaagacat
cagtgttcctacttagtgaacctccatgtaaatgatttccttcatgttggtggggacccc
aagtggcttaatggtttagagaatgctcctcaaaaactacaaaatttaggagaacttaac
aaagtgttagcccataggccttggcttattaccaaagaacatattgagggacttttaaaa
gctgaagagcacagctggtcccttgcagaactggtacatgcagtagttctcctcacacac
tatcattctcttgcttcattcacatttggctgtggaatcagtccagaaattcattgtgat
ggtggccatacgttcagacctccttcggttagtaactactgcatctgtgacattacaaat
ggcaatcacagtatggatgaaatgcaggtcaactcagcaggaaatgtttcggtaagtgat
tccttctttgaggttgaagccctcatggaaaagatgaggcagttacaggaatgtcgagat
gaagaagaggcaagtcaggaagagatggcttcacgttttgaaatagaaaaaagggagagc
atgtttgtcttctcttcagatgatgaagaagtcacaccagcaagagatgtatctcgtcac
tttgaggatactagttatggctataaggatttctctagacatgggatgcatgttccaaca
tttcgagttcaggactattgctgggaagaccatggttattctttggtaaatcgcctttat
ccagatgtgggacagttgattgatgaaaaatttcacattgcttacaatcttacttataac
acaatggcaatgcacaaagatgtcgatacctcaatgcttagacgggctatttggaactat
attcactgcatgtttggaataagatatgacgactatgactatggtgaaattaaccagcta
ttggatcgtagctttaaagtttatatcaaaactgttgtttgcactcccgaaaaagttacc
aaaagaatgtatgatagcttctggaggcagtttaagcactctgagaaggttcatgttaat
ctgcttcttatagaagctagaatgcaagcagaactcctctacgctctgagagccattacc
cgctatatgacctga

KEGG   Vulpes vulpes (red fox): 112931735
Entry
112931735         CDS       T05911                                 

Gene name
SESN2
Definition
(RefSeq) sestrin-2
  KO
K20394  sestrin 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp04150  mTOR signaling pathway
vvp04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    112931735 (SESN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112931735 (SESN2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    112931735 (SESN2)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 112931735
NCBI-ProteinID: XP_025870235
UniProt: A0A3Q7USL6
LinkDB
Position
Unknown
AA seq 484 aa
MIVADSECRAELKGYLPFAPGGGGGGGGGPGAGEEQRESRARRGPRGPSAFIPVEEVLQE
GAESLEQHLRLEALMSSGRVDNLAVVMGLHPDYLSCFWRLHYLLLHTDGPLASSWRHYIA
IMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKE
HIQALLKTGEHSWSLAELIQALVLLTHCHSLASFVFGCGILPEGDSEGSPAPQAPSPPSG
QSSPPSRDPMNNSGGFEAARDVEALMERMRQLQESLLRDEGASQEEMESRFELEKSESLL
VTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAEAPPTFRAQDYTWEDHGYSLIQRLY
PEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSMLRRAIWNYIHCVFGIRYDDYDYGEVNQL
LERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAIT
RYMT
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgatcgttgcagactccgagtgccgcgcagagctcaagggctacctgccgttcgccccg
ggcggcggcggcggcggcggcggcggccccggggcgggagaggagcagagggaaagccgg
gctcggcgaggcccccgagggcccagtgccttcatcccagtagaggaggtccttcaggag
ggagctgagagcctggagcagcacctgaggctagaggcactgatgtcctctggacgggtg
gacaatctggcagtggtgatgggcctgcaccctgactatcttagctgcttttggcgtctg
cactacctcttgctgcacacagacgggcccctggccagctcctggcgccactacattgcc
atcatggctgccgcccgccatcagtgttcttacttggtgggttctcacatggctgagttt
ctacagacgggtggtgaccctgagtggctacttggtctccatcgtgcccccgagaagcta
cgcaagctcagtgagatcaacaagttgctggcacaccggccatggctcatcaccaaggaa
catatccaggccttgctgaagacaggcgagcacagctggtctctggcagagctcatccag
gcactggtcctgctcacccactgccattcactggcctcctttgtgtttggctgtggcatc
ctccctgagggggactcagagggcagccctgccccccaggcaccttcaccccccagtggg
cagagtagcccacccagcagggacccaatgaacaactctgggggctttgaggctgcccga
gacgtggaagctttgatggaacgcatgaggcagctccaggagagtctgttacgggatgag
ggagcatcccaggaggagatggagagccgctttgagctggagaagtcggagagccttctg
gtgactccctcagccgacatcctggagccttctccacacccagacatgctgtgctttgtg
gaggacccgactttcggatatgaggactttacccggcgaggggctgaggcgccccccacc
ttccgtgcccaggattatacctgggaagaccatggctattcactgatccagcggctttac
cctgagggtgggcagctgctggatgagaagttccaggcagcctatagccttacctacaac
accattgccatgcacagtggagtagacacctccatgctccgaagggccatctggaattac
atccactgtgtctttgggatcagatatgatgactacgactacggggaggtgaaccagctc
ttggaacggaacctcaaggtctatatcaagacggtggcctgctacccagagaagaccacg
cgaagaatgtacaacctcttctggaggcacttccgccactcagagaaggtccacgtgaac
ttgctgctcttggaggcccgtatgcaggctgccttgctctacgccctccgtgccatcacc
cgctacatgacctga

DBGET integrated database retrieval system