KEGG   Vulpes vulpes (red fox): 112915979
Entry
112915979         CDS       T05911                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04110  Cell cycle
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04310  Wnt signaling pathway
vvp04350  TGF-beta signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04630  JAK-STAT signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp05132  Salmonella infection
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05216  Thyroid cancer
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112915979 (MYC)
   04012 ErbB signaling pathway
    112915979 (MYC)
   04310 Wnt signaling pathway
    112915979 (MYC)
   04350 TGF-beta signaling pathway
    112915979 (MYC)
   04390 Hippo signaling pathway
    112915979 (MYC)
   04630 JAK-STAT signaling pathway
    112915979 (MYC)
   04151 PI3K-Akt signaling pathway
    112915979 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112915979 (MYC)
   04218 Cellular senescence
    112915979 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112915979 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112915979 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112915979 (MYC)
   05202 Transcriptional misregulation in cancer
    112915979 (MYC)
   05206 MicroRNAs in cancer
    112915979 (MYC)
   05205 Proteoglycans in cancer
    112915979 (MYC)
   05230 Central carbon metabolism in cancer
    112915979 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112915979 (MYC)
   05225 Hepatocellular carcinoma
    112915979 (MYC)
   05226 Gastric cancer
    112915979 (MYC)
   05216 Thyroid cancer
    112915979 (MYC)
   05221 Acute myeloid leukemia
    112915979 (MYC)
   05220 Chronic myeloid leukemia
    112915979 (MYC)
   05219 Bladder cancer
    112915979 (MYC)
   05213 Endometrial cancer
    112915979 (MYC)
   05224 Breast cancer
    112915979 (MYC)
   05222 Small cell lung cancer
    112915979 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112915979 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112915979 (MYC)
   05161 Hepatitis B
    112915979 (MYC)
   05160 Hepatitis C
    112915979 (MYC)
   05163 Human cytomegalovirus infection
    112915979 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112915979 (MYC)
   05169 Epstein-Barr virus infection
    112915979 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112915979 (MYC)
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112915979 (MYC)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    112915979 (MYC)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     112915979 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 112915979
NCBI-ProteinID: XP_025849233
UniProt: A0A3Q7S0M0
LinkDB
Position
Unknown
AA seq 439 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSPARGPGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSAAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRARLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLLSEKDLL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcctctcaacgtcagcttcgccaataggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccg
ctgtccccgagccgccgctccgggctctgctcgccctcctacgttgcagtcgcgtccttc
tccccccggggggacgatgacggcggcggcggcagcttctccaccgccgaccagttggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgcatgtggagcggcttctcggcc
gccgccaagctcgtctcggagaagctggcctcctaccaggctgcgcgcaaagacagcggc
agcccgagccccgcccgcgggcccggcggctgctccacctccagcctgtacctgcaggac
ctgagcgccgccgcctccgagtgcatcgacccctccgtggtcttcccctacccgctcaat
gacagcagctcgcccaagccctgcgcctcccccgactcggccgccttctccccgtcctcg
gactctctgctctcctcggccgagtcctccccgcgggccagccccgagcccctggcgctg
cacgaggagacaccgcccaccaccagcagcgactcggaggaagaacaagaggacgaagaa
gaaattgatgttgtttctgtggaaaaaaggcagccccctgccaaaaggtccgaatcgggg
tccccctctgctggaggccacagcaaacctcctcatagcccgctggtccttaagagatgc
catgtgtccacccatcagcacaactacgcggcacccccctccaccaggaaggactatccc
gccgccaagagggcgaggttggacagtggtagagtcctgaaacagatcagcaacaaccgc
aaatgtgccagccccaggtcttcggacacggaggagaatgacaagaggcgaacacacaac
gtcttggagcgccagaggaggaacgagctgaaacggagcttctttgccctgcgtgatcag
atcccggagttggaaaacaatgaaaaggcccccaaggtagtgatccttaaaaaagccacc
gcgtacatcctgtccgtccaagccgaggagcaaaagctcctttccgaaaaggacttgttg
aggaagcggcgagaacagttgaaacacaaactggaacagctaaggaactctggtgcctaa

DBGET integrated database retrieval system