KEGG   Vulpes vulpes (red fox): 112916157
Entry
112916157         CDS       T05911                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04520  Adherens junction
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05132  Salmonella infection
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05221  Acute myeloid leukemia
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112916157 (TCF7L2)
   04390 Hippo signaling pathway
    112916157 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112916157 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112916157 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112916157 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112916157 (TCF7L2)
   05225 Hepatocellular carcinoma
    112916157 (TCF7L2)
   05226 Gastric cancer
    112916157 (TCF7L2)
   05216 Thyroid cancer
    112916157 (TCF7L2)
   05221 Acute myeloid leukemia
    112916157 (TCF7L2)
   05217 Basal cell carcinoma
    112916157 (TCF7L2)
   05215 Prostate cancer
    112916157 (TCF7L2)
   05213 Endometrial cancer
    112916157 (TCF7L2)
   05224 Breast cancer
    112916157 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112916157 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112916157 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112916157 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    112916157 (TCF7L2)
   05165 Human papillomavirus infection
    112916157 (TCF7L2)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    112916157 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 112916157
NCBI-ProteinID: XP_025849454
UniProt: A0A3Q7RVK4
LinkDB
Position
Unknown
AA seq 394 aa
MKWPLLDVQAGTLQSRQALKDARSPSPAHIVQCPLPCCTQGHDCQHFYPPSDFTVSTQVF
RDMKRSHSLHKVGEPWCLESNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVD
PKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALT
VNASMSSFLSSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSK
KEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYY
ELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSA
PKKCRARFGLDQQNNWCGPCRCKYSKEVSGTVRA
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaaatggccactgcttgacgtccaggcggggaccctccagagtagacaagccctcaag
gatgcccgctctccgtcaccggcacacattgtccagtgccccctcccttgctgcactcag
ggacatgactgtcagcacttctaccccccctcagacttcactgtcagcactcaagtcttc
agggacatgaaaaggagccactccttacacaaggttggggagccctggtgtttggagtcg
aacaaagtgcccgtcgtgcagcaccctcaccatgttcaccctctcacgccgctcatcacg
tacagcaatgagcacttcaccccgggaaacccacctccacacttaccagctgacgtagac
cccaaaacaggaatcccacggcctccgcaccctccagatatatctccgtattacccgcta
tcgcccggcaccgtaggacaaatcccccatccgctaggatggttagtaccacagcaaggt
cagccagtgtacccaatcacgacaggaggattccgtcacccttaccccacagctctgacc
gtcaacgcttccatgtccagcttcctgtcttccaggttccctccccatatggtcccacca
catcacactctacatacgaccggcatcccccacccggccatagtcacgccaacagtcaaa
caggaatcctcccagagtgacgtcggctcactccacagctcaaagcatcaggactccaaa
aaggaagaagaaaagaagaagccccacataaagaaacctcttaatgcattcatgttgtat
atgaaggaaatgagggccaaggtcgtggccgagtgcacgttgaaagaaagtgcggccatc
aaccagatcctggggcgaaggtggcacgcactgtccagagaagagcaagcgaaatactac
gagctggcccggaaggagcgacagcttcacatgcagctgtaccccggctggtctgcgcgg
gataactatggcaagaagaagaagaggaaaagggacaagcagcctggagagaccaatgaa
cacagcgaatgtttcctaaatccttgcctttcacttcctccgattacagacctgagcgct
cctaagaaatgccgagcgcgctttggccttgatcaacagaataactggtgcggcccttgc
agatgcaaatactccaaagaagtgtcgggcactgttcgggcttga

KEGG   Vulpes vulpes (red fox): 112916685
Entry
112916685         CDS       T05911                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04520  Adherens junction
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05132  Salmonella infection
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05221  Acute myeloid leukemia
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112916685 (TCF7L1)
   04390 Hippo signaling pathway
    112916685 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112916685 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112916685 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112916685 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112916685 (TCF7L1)
   05225 Hepatocellular carcinoma
    112916685 (TCF7L1)
   05226 Gastric cancer
    112916685 (TCF7L1)
   05216 Thyroid cancer
    112916685 (TCF7L1)
   05221 Acute myeloid leukemia
    112916685 (TCF7L1)
   05217 Basal cell carcinoma
    112916685 (TCF7L1)
   05215 Prostate cancer
    112916685 (TCF7L1)
   05213 Endometrial cancer
    112916685 (TCF7L1)
   05224 Breast cancer
    112916685 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112916685 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112916685 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112916685 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    112916685 (TCF7L1)
   05165 Human papillomavirus infection
    112916685 (TCF7L1)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    112916685 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 112916685
NCBI-ProteinID: XP_025850220
UniProt: A0A3Q7T5V6
LinkDB
Position
Unknown
AA seq 464 aa
MIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQPP
HHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTAGIPRPPHPSELSPYYPLSPGAVGQI
PHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSG
IPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKV
VAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKK
RKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKSCDSPASSHGSMLDSPATPSA
ALASPAAPAATHSEQAQPLSLTTKPESRAQLALHSAAFLSAKATATSSGQMGSQPPLLSR
PLPLGSLPTALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatcccggacttgagcagtccgtacctctccaacggacccttgtctcccggaggagcg
cgcacgtacctgcagatgaaatggcccctcctcgatgtcccctccagtgccacggtcaag
gacaccaggtcaccatccccagcacacttgtctaataaagttcctgttgttcagcccccg
catcacatgcacccgttgacgcccctcatcacctacagcaacgaccacttttcccctggc
tcccctcccacacacctctccccagagatcgatccaaagacagcaggaatccctcggcct
cctcacccatctgagctgtctccatattacccactgtctcctggagctgttggacaaatt
ccccatccccttggctggctcgtcccacagcaaggacagcccatgtactctcttcctcct
ggtggtttccggcacccctaccctgccctcgccatgaacgcctcaatgtccagcctggtt
tccagtcggttctctcctcacatggtggctcccgcccatcctggtctgcccacctcaggg
attccccaccccgccatcgtctcccccattgtcaagcaagagccagcgccccccagcctg
agcccagccgtgagcgcgaaatcaccagtcacggtgaaaaaggaggaagaaaagaaaccc
catgtgaagaagcctcttaatgccttcatgttatatatgaaggagatgagggccaaggtg
gtggctgagtgcaccctgaaggaaagtgcagccattaaccaaatcctgggaagaaagtgg
cacaacctgtcccgagaagaacaggccaagtactatgaactggcccggaaggagcggcag
cttcactcccagctctacccaacctggtcagcccgggacaactatggtaagaaaaagaag
aggaagagagaaaagcagctgtcacagacacagtcccagcagcaagtccaagaggcagag
ggtgctctggcctccaaaagcaagaagccatgtgttcagtacctgccccctgagaagtcc
tgtgacagccctgcctcttcccatggcagcatgctggattccccggccactccctccgca
gccttggcatcaccagctgcccccgcagcaactcactcagagcaagcccagcccctctcc
ctcaccaccaagccagagagccgggcccagctggctttacactcagctgccttcctgtca
gctaaggcaacagccacctcctctggccagatgggcagccagcccccccttctctcccgg
cccctgcccctcgggtccctgcccacagctctgctgacctctcccccctccttcccagcc
acactccatgcccaccaggccctccccgtgctccaggcccagcctctttccttggtcacc
aagtctgcccactga

KEGG   Vulpes vulpes (red fox): 112917059
Entry
112917059         CDS       T05911                                 

Gene name
TCF7
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor 7
  KO
K02620  transcription factor 7
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04520  Adherens junction
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05132  Salmonella infection
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05221  Acute myeloid leukemia
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112917059 (TCF7)
   04390 Hippo signaling pathway
    112917059 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112917059 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    112917059 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112917059 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112917059 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112917059 (TCF7)
   05225 Hepatocellular carcinoma
    112917059 (TCF7)
   05226 Gastric cancer
    112917059 (TCF7)
   05216 Thyroid cancer
    112917059 (TCF7)
   05221 Acute myeloid leukemia
    112917059 (TCF7)
   05217 Basal cell carcinoma
    112917059 (TCF7)
   05215 Prostate cancer
    112917059 (TCF7)
   05213 Endometrial cancer
    112917059 (TCF7)
   05224 Breast cancer
    112917059 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112917059 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112917059 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112917059 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    112917059 (TCF7)
   05165 Human papillomavirus infection
    112917059 (TCF7)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    112917059 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 Peptidase_M13
Other DBs
NCBI-GeneID: 112917059
NCBI-ProteinID: XP_025850689
UniProt: A0A3Q7RYQ6
LinkDB
Position
Unknown
AA seq 383 aa
MYKDTVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPAHSVPQLSPLYEHFSSPHPTS
APADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIP
HPAIVPPSGKQELQPYDRSLKTQAESKVEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECT
LKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREK
HQESTTDPGSPKKCRARFGLNQQTDWCGPCRRKKKCIRYLPGEGRCPSPVPSDDSALGCP
GSPAPQDSPSYLLLPHFPTELLASPAERRLHHQVFQPLSASQPPGPPRSPPAPCRVHKCN
NSNLRDRQPSMHGTPGYLQGPIL
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgtacaaagacacggtctactcggccttcaatctgctcatgcactacccacccccgtcg
ggagcagggcagcacccccagcctcagcctccgctgcacaacaaggccagtcagccagcc
cacagtgtcccacaactctctcctctctatgaacatttcagcagcccacaccctacatct
gcaccagccgacatcagccagaagcaaggcgttcacaggcctctgcagacccctgacctc
tccggcttctactctctgacctcaggcagtatgggacaactcccccacaccgtgagctgg
ttcacccatccatccctgatgctgggctctggtgtacctggtcaccccgcagccatcccc
cacccggccatcgtacctccctcggggaagcaggagctgcagccatatgatcgcagcctg
aagacacaggcagaatccaaggtggagaaggaggccaagaagccaaccatcaagaagccc
ctcaacgccttcatgctgtatatgaaggagatgagagccaaggtcattgcagagtgcaca
ctcaaggagagtgctgctatcaaccagatcctgggccgtaggtggcacgccctatctcgg
gaagagcaggccaagtattacgagctggcccgaaaagagaggcagttgcacatgcagctg
tacccaggctggtcggcgcgggacaactatgggaaaaagaaaaggcggtcacgggaaaag
caccaggaatctaccacagaccctggctcgcctaagaaatgccgtgctcgctttggcctc
aaccagcagacggattggtgtggtccgtgcaggaggaaaaagaaatgcattcggtactta
cccggagaaggccgctgccccagccccgttccttccgatgacagtgctctaggctgcccc
gggtccccagccccccaggactcgccctcatacctcctgctgccccacttccccacagaa
ctgcttgccagccctgcggagcggcgcctacatcaccaggtctttcagccgctctcagcc
tcccagccccctggaccccccagatcccccccagcgccctgcagagtacacaagtgcaac
aacagcaatctcagagacaggcaacctagcatgcacgggacacctggctacctccagggg
cccatcctctga

KEGG   Vulpes vulpes (red fox): 112934208
Entry
112934208         CDS       T05911                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04520  Adherens junction
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05132  Salmonella infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05221  Acute myeloid leukemia
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112934208 (LEF1)
   04390 Hippo signaling pathway
    112934208 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112934208 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112934208 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112934208 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112934208 (LEF1)
   05225 Hepatocellular carcinoma
    112934208 (LEF1)
   05226 Gastric cancer
    112934208 (LEF1)
   05216 Thyroid cancer
    112934208 (LEF1)
   05221 Acute myeloid leukemia
    112934208 (LEF1)
   05217 Basal cell carcinoma
    112934208 (LEF1)
   05215 Prostate cancer
    112934208 (LEF1)
   05213 Endometrial cancer
    112934208 (LEF1)
   05224 Breast cancer
    112934208 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112934208 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112934208 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112934208 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    112934208 (LEF1)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    112934208 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 112934208
NCBI-ProteinID: XP_025873379
UniProt: A0A3Q7T8H5
LinkDB
Position
Unknown
AA seq 415 aa
MPQLSGAGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVN
ESEIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPN
MNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHLPSDVN
SKQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSM
SRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHI
KKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLH
MQLYPGWSARDNYGKKKKRKREKLQESTSGGKRNSFPTCKAKAATPGPLLEMEAC
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggccggcggcggcggcggcgggggagacccggaactctgcgcc
accgacgaaatgatccctttcaaggatgagggcgatcctcagaaggagaagatcttcgca
gaaatcagccaccccgaagaggaaggcgacctcgccgacatcaagtcgtccttagtgaac
gagtccgaaatcatcccagccagcaacggacacgaggtggccagacaagcacaaacctct
caggagtcctaccacgacaaggccagagaacaccctgatgacggaaagcatccagatgga
ggcctctacaacaagggaccctcctactcgagctattccgggtacataatgatgccaaat
atgaataatgacccatacatgtccaatggatctctttctccacccatcccaagaacatca
aataaggtgcccgtggtgcagccatcacatgcagtccatcctctcacccccctcatcacg
tacagcgacgagcacttttctccaggatcacacccttcacacctcccatcagatgtcaac
tccaaacaaggcatgtctagacatcctccagctcctgagatccctaccttttatcccctg
tctccaggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtatat
cccatcacgggaggattcaggcaaccctatccatcctcactgtcagtcgacacttccatg
tccaggttttcccatcatatgattcctggtcctcctggtccccatacaactggcatccct
catccagctattgtaacgcctcaggtcaaacaggagcatccccacactgacagtgatcta
atgcacgtgaagcctcagcatgaacagagaaaggaacaggagccaaaaagacctcacatt
aagaagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgtagct
gagtgtaccctaaaagaaagtgcagctatcaaccagattctaggcagaaggtggcatgcc
ctctcccgtgaagagcaggccaaatattatgaattagcacggaaggaaagacagctacat
atgcagctctatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaag
agagagaaactccaggaatcaacatcaggtggaaaacgaaactcattcccaacgtgcaaa
gccaaggcagcgaccccgggacctcttctggagatggaagcttgttga

DBGET integrated database retrieval system