KEGG   Vulpes vulpes (red fox): 112916202
Entry
112916202         CDS       T05911                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04218  Cellular senescence
vvp04714  Thermogenesis
vvp04910  Insulin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    112916202 (RHEB)
   04151 PI3K-Akt signaling pathway
    112916202 (RHEB)
   04152 AMPK signaling pathway
    112916202 (RHEB)
   04150 mTOR signaling pathway
    112916202 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112916202 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    112916202 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112916202 (RHEB)
   04919 Thyroid hormone signaling pathway
    112916202 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    112916202 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    112916202 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    112916202 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112916202 (RHEB)
   05163 Human cytomegalovirus infection
    112916202 (RHEB)
   05165 Human papillomavirus infection
    112916202 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:vvp04031]
    112916202 (RHEB)
GTP-binding proteins [BR:vvp04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    112916202 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase
Other DBs
NCBI-GeneID: 112916202
NCBI-ProteinID: XP_025849553
UniProt: A0A3Q7S1H1
LinkDB
Position
Unknown
AA seq 179 aa
MPIHTEPLLSFIGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQD
EYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHM
ERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSSCSVM
NT seq 540 nt   +upstreamnt  +downstreamnt
atgccaatacatactgagcctttgctctcttttatagggaaatcctcattgacgattcag
tttgttgaaggccaatttgttgactcctacgacccaaccatagaaaacactttcacaaaa
ttgatcacagtcaatggacaagaatatcatcttcaacttgtcgacacagccgggcaagat
gaatactccatctttcctcagacatactccatagatattaatggttatattcttgtgtat
tctgttacatcaatcaaaagttttgaagtgattaaagttattcatggcaaattgttggac
atggtggggaaagtgcaaatacctattatgttggttgggaataagaaagacctacatatg
gaaagggtgatcagttatgaagaagggaaagcgttagcagagtcttggaacgccgccttt
ttggaatcttctgctaaagaaaatcagacggctgttgatgtttttagaaggataattttg
gaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcctgctcggtgatgtaa

DBGET integrated database retrieval system