KEGG   Vulpes vulpes (red fox): 112916218
Entry
112916218         CDS       T05911                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00220  Arginine biosynthesis
vvp00330  Arginine and proline metabolism
vvp01100  Metabolic pathways
vvp04020  Calcium signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04370  VEGF signaling pathway
vvp04371  Apelin signaling pathway
vvp04611  Platelet activation
vvp04915  Estrogen signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04926  Relaxin signaling pathway
vvp04931  Insulin resistance
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    112916218 (NOS3)
   00330 Arginine and proline metabolism
    112916218 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112916218 (NOS3)
   04371 Apelin signaling pathway
    112916218 (NOS3)
   04066 HIF-1 signaling pathway
    112916218 (NOS3)
   04020 Calcium signaling pathway
    112916218 (NOS3)
   04071 Sphingolipid signaling pathway
    112916218 (NOS3)
   04022 cGMP-PKG signaling pathway
    112916218 (NOS3)
   04151 PI3K-Akt signaling pathway
    112916218 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112916218 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112916218 (NOS3)
   04921 Oxytocin signaling pathway
    112916218 (NOS3)
   04926 Relaxin signaling pathway
    112916218 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112916218 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112916218 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112916218 (NOS3)
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     112916218 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 112916218
NCBI-ProteinID: XP_025849586
UniProt: A0A3Q7S4F7
LinkDB
Position
Unknown
AA seq 1213 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPTSEPSRAPALAPPPSPPPAPDHSSPP
LTRPPDGPKFPRVKNWEVGSITYDTLSAQSQQDGPCTPRRCLGSLVFPRKLQSRPSQDPA
PPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRASGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDE
PPELFALPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYM
STEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIV
DHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQTD
PWKGSASKGAGVTRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
SSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKQSSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKA
AARDIFSPKRTWKRQRYRLSAQAEGLQLLPGLIHVHRRKMVQATVLAVENLQSSKSTRAT
ILVRLDTGSQEALQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPGEPVAVEQLEKGSPD
LPCTPSPGGPPPSWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEESSEQQEL
ESLSQDPRRYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHP
GEIHLTVAVLAYRTQDGLGPLHYGVCSTWLSQLKAGDPVPCFIRGAPSFRLPPDPSLPCI
LVGPGTGIAPFRGFWQERLHDIDSKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVF
GRVLTAFSREPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRI
LATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVP
WAFDPPGPDTAGP
NT seq 3642 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcccgggcccccttgtggcctggggctgggc
ctgggcctggggctatgtggcaagcagggccctgcctccccgacctcagagcccagccgg
gcaccggccctggcgcccccaccctcacccccaccagcaccagaccacagcagccccccg
ctcacccggcctccagatgggcccaagttccctcgtgtgaagaactgggaggtggggagc
atcacttatgacaccttgagtgcccagtcacagcaggatgggccctgcaccccgagacgc
tgtctgggctctctggtatttccacggaaactgcagagccggccctcccaggaccctgca
ccccctgagcagctgctgagccaggccagggacttcatcaaccagtactacagctccatc
aagaggagtggctcccaggcccatgagcagaggcttcaagaggtggaagctgaggtagca
gccacaggcacctatcagcttcgggaaagcgagctggtgttcggggccaagcaggcctgg
cgaaacgctccccgctgcgtgggccggatccagtgggggaagctgcaggtgtttgatgcc
cgggattgcagttctgcccaggagatgttcacctacatctgcaaccacatcaagtatgcc
accaaccggggcaacctccgctcggccatcacagtgttcccccagcgtgcctcaggccgc
ggagacttccgaatttggaacagccagctggtgcgctatgcgggctacagacagcaggat
ggctcagtgcggggggacccagccaacgtggagatcactgagctctgcatccagcacggc
tggactccaggaaacggccgctttgatgtgctgcccctactgctccaggccccagatgag
cccccagaactctttgctctgccccccgagctggttctcgaggtgcccctggagcacccc
acgctggagtggtttgcagccctgggcctgcgctggtatgccctcccagcggtgagcaac
atgctgctggaaattggggggctggagttccctgcggcccccttcagcggctggtacatg
agcactgagattggcacgcggaacctgtgtgaccctcatcgatacaacatcctggaggat
gtggctgtctgcatggacttggataccaggaccacctcatccctgtggaaagacaaggca
gcagtggaaatcaacttggctgtgctgcacagttaccagctggccaaagtgaccatcgtg
gaccaccatgctgccacagcctccttcatgaagcacctggagaacgagcagaaggccagg
gggggttgccctgctgactgggcctggatcgtgccccccatctctggcagcctcacccct
gttttccatcaggagatggtcaactatgtcctgtccccggccttccgctatcagacagac
ccgtggaaggggagtgcatccaagggtgccggcgtcaccaggaagaaaacctttaaggaa
gtggccaatgcggtgaagatctctgcctcactcatgggcactgtgatggcaaagcgagtg
aaggcgacaatcctctatggctccgagactggccgggcccagagctatgcacagcagctg
gggagactcttccggaaggctttcgacccccgggtcctgtgcatggatgagtatgacgtg
gtgtcccttgagcatgagacgctggtgttggtggtgaccagcacatttgggaatggtgat
cccccagagaatggagagagttttgcggcggccctgatggagatgtcgggtccctacaac
agctcccctcggccagaacagcacaagagttacaaaatccgcttcaacagtgtctcctgc
tcagacccactggtgtcctcctggaggcggaagagaaagcagtccagtaacacagacagt
gctggggcactgggtaccctcaggttctgtgtgttcgggctgggctcccgggcatacccc
cacttttgtgcctttgctcgtgcggtggacacacggctggaagagctgggtggggagcgg
ctgctgcagctgggccaaggagatgagctgtgtggccaggaggaggccttccgaggctgg
gcccaggccgccttccaggcctcctgtgagaccttctgcgtgggagaggatgccaaggct
gccgcccgggacatattcagccccaaacggacctggaagcgccagaggtaccggctgagc
gcccaggctgagggcctccagctgctgccaggactgatccatgtgcacaggaggaagatg
gtccaggctactgtcctcgcggtggaaaacctgcaaagcagcaagtccacccgggccacg
atcctggtgcgcctggacactggaagccaggaggcgctgcagtaccagccaggggaccac
attggcatctgcccgcccaaccggcctggccttgtggaggcgctgctgagccgggtggag
gatccaccgccaccaggagagccagtggcagtggagcagctggagaagggcagccctgat
ctcccctgtacaccatcaccaggtggcccaccccccagctgggttcgggaccctcgcctg
cccccatgcacactgcgccaggctctcaccttcttcctggacatcacttccccgcccagc
cctcaactccttcgactgctcagcaccctggctgaagagtccagtgaacagcaggagctt
gagagcctcagccaggacccccggcgctatgaggaatggaagtggttccgctgccccaca
ctgctggaggtactggaacagttcccatcggtggcactgcccgcccccctgctcctcacc
cagctgcccctgctccagccccggtactactcggtcagctcagcacccagtgcccaccca
ggagagatccacctcacagtagctgtgctggcatacaggacacaggatggactgggcccc
cttcattatggagtctgctccacatggctaagccaacttaaggccggagatcctgtaccc
tgcttcatcaggggggctccctccttccggctgccacctgatcccagtctgccttgcatc
ctagtgggtcctggtacgggtattgccccctttcggggtttctggcaggagcggctgcac
gacattgacagcaaagggctgcagcccgcccccatgactctggtgttcggctgccgatgc
tcccagctcgaccacctttaccgcgacgaggtgcaggatgcccagcagcgcggagttttt
gggcgcgtcctcaccgccttctcccgggagcccgacagccctaagacgtacgtgcaggac
atcctgcggacggagctggctgctgaggtgcaccgcgtgctgtgcctcgagcggggccac
atgtttgtgtgcggcgacgtcaccatggcaaccagcgtcctgcagacggtgcagcgaatc
ctagcgacggagggcgacatggagctggacgaggccggtgacgtcatcggcgtgctgcgg
gatcagcaacgctatcacgaggacattttcgggctcacactgcgcacccaggaggtgacg
agccgcatacgcacccagagcttctccttgcaggagcggcatctgcggggcgcggtgccc
tgggcgttcgacccgcccggcccagacaccgccggcccctga

DBGET integrated database retrieval system