KEGG   Vulpes vulpes (red fox): 112916519
Entry
112916519         CDS       T05911                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2
  KO
K03259  translation initiation factor 4E
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp03013  RNA transport
vvp04066  HIF-1 signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04211  Longevity regulating pathway
vvp04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    112916519
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112916519
   04151 PI3K-Akt signaling pathway
    112916519
   04150 mTOR signaling pathway
    112916519
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112916519
  09149 Aging
   04211 Longevity regulating pathway
    112916519
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112916519
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     112916519
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112916519
Translation factors [BR:vvp03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    112916519
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 112916519
NCBI-ProteinID: XP_025850043
UniProt: A0A3Q7S2R6
LinkDB
Position
Unknown
AA seq 245 aa
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQGSSKRKAVVPGPAEHPLQYNY
TFWYSRRAPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaaaagtcagggc
agcagtaagaggaaggctgttgtccctgggccagcagagcatcccctgcagtacaactat
actttctggtactccagaagagcccctggccgtcccaccagctcacagagctatgaacag
aatatcaaacagatcggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcctggggacctgacaggtcacagtgacttccatctcttcaaagaaggaatt
aagcccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcgactgcgg
aagggcttggcatcccgttgctgggagaatctcatcctggccatgttgggggaacagttc
atggttggggaggagatctgtggggctgtggtctctgtccggtttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgcatccgggataccctt
cggcgagtgcttaacctacctcccaacaccattatggagtacaaaacccacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

KEGG   Vulpes vulpes (red fox): 112925497
Entry
112925497         CDS       T05911                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2 isoform X1
  KO
K03259  translation initiation factor 4E
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp03013  RNA transport
vvp04066  HIF-1 signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04211  Longevity regulating pathway
vvp04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    112925497 (EIF4E2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112925497 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    112925497 (EIF4E2)
   04150 mTOR signaling pathway
    112925497 (EIF4E2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112925497 (EIF4E2)
  09149 Aging
   04211 Longevity regulating pathway
    112925497 (EIF4E2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112925497 (EIF4E2)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     112925497 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112925497 (EIF4E2)
Translation factors [BR:vvp03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    112925497 (EIF4E2)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 112925497
NCBI-ProteinID: XP_025862026
UniProt: A0A3Q7T138
LinkDB
Position
Unknown
AA seq 253 aa
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQGSSKRKAVVPGPAEHPLQYNY
TFWYSRRAPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTNSIKYVLGVLGGHIPKLSRNRS
LVGPRGICGCTGA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagatgatgatagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaaaagtcagggc
agcagtaagaggaaggctgttgtccctgggccagcagagcatcccctgcagtacaactat
actttctggtactccagaagagcccctggccgtcccaccagctcacagagctatgaacag
aatatcaaacagatcggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcctggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aagcccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcgactgcgg
aagggcttggcatcccgttgctgggagaatctcatcctggccatgttgggggaacagttc
atggttggggaggagatctgtggggctgtggtctctgtccggtttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgcatccgggataccctt
cggcgagtgcttaacctacctcccaacaccattatggagtacaaaacccacaccaatagc
atcaagtatgtgttgggggtgctcggggggcatatccctaagcttagcagaaataggtcc
ttagttgggcccagagggatatgtggttgtacaggagcctga

KEGG   Vulpes vulpes (red fox): 112927950
Entry
112927950         CDS       T05911                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 1B
  KO
K03259  translation initiation factor 4E
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp03013  RNA transport
vvp04066  HIF-1 signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04211  Longevity regulating pathway
vvp04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    112927950 (EIF4E1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112927950 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    112927950 (EIF4E1B)
   04150 mTOR signaling pathway
    112927950 (EIF4E1B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112927950 (EIF4E1B)
  09149 Aging
   04211 Longevity regulating pathway
    112927950 (EIF4E1B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112927950 (EIF4E1B)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     112927950 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112927950 (EIF4E1B)
Translation factors [BR:vvp03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    112927950 (EIF4E1B)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 112927950
NCBI-ProteinID: XP_025865239
UniProt: A0A3Q7SR10
LinkDB
Position
Unknown
AA seq 240 aa
MATASPAREAESGIRKWEEKEEKKDEKEGAEGAMNTPGALLSQRGKAQDGGPPGVKLELH
PLLNRWALWFFKNDRSRTWQDNLRLVTKFDTVEDFWAMYSHIQLASKLSSGCDYALFKDG
IEPMWEDSRNKRGGRWLVSLAKQQRHSELDRLWLETLLCLIGESFEEHSREVCGAVINIR
TKGDKIAVWTREAENQEGVLHIGRVYKERLGLSTKIVIGYQAHADTATKSNSLAKNKFVV
NT seq 723 nt   +upstreamnt  +downstreamnt
atggctaccgccagccctgccagggaggctgagagtggaatccgaaagtgggaggagaag
gaggaaaaaaaagatgagaaagaaggggcagagggggctatgaatacccctggggccctg
ctgtcccagagggggaaggcccaggatgggggtcccccgggggtcaagttggagttacat
ccgctgctgaacaggtgggctctatggttctttaagaatgaccgcagccgaacctggcag
gacaacttgcgtctggtcaccaagtttgacaccgtggaagacttttgggcgatgtacagt
cacatccagctggccagtaagctttcttccggctgtgactacgccctgttcaaggatggc
attgagcccatgtgggaagatagcaggaataagaggggtggccgctggctggtcagtctc
gccaagcagcagcgccacagtgagctggaccgcctgtggctggagacactgctgtgtctg
atcggggagagctttgaggagcacagccgggaggtgtgtggggctgttatcaacattcga
accaagggggacaagattgccgtgtggacgagggaggcagagaaccaggagggcgtgctg
cacattgggcgggtctacaaggagcgcctgggcctctctacgaagattgtcattgggtac
caggctcatgcagacacggccaccaagagcaactccctagccaagaataagtttgtggtg
tga

KEGG   Vulpes vulpes (red fox): 112928517
Entry
112928517         CDS       T05911                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2-like isoform X1
  KO
K03259  translation initiation factor 4E
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp03013  RNA transport
vvp04066  HIF-1 signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04211  Longevity regulating pathway
vvp04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    112928517
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112928517
   04151 PI3K-Akt signaling pathway
    112928517
   04150 mTOR signaling pathway
    112928517
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112928517
  09149 Aging
   04211 Longevity regulating pathway
    112928517
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112928517
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     112928517
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112928517
Translation factors [BR:vvp03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    112928517
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 112928517
NCBI-ProteinID: XP_025866117
UniProt: A0A3Q7TY49
LinkDB
Position
Unknown
AA seq 197 aa
MNNKFNALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQGSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGCPTSSQSFEQIGTFASVEQFWRFYSHMVHPRDLTGHSDFRLFKEGVKPMW
EDDANKNGGKWIIRLQKGLTSRCWENLILAMLGEQFMVGEEICGAVISVQFQEDIISIWN
KTSSDQATTARIRDTLR
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaacaacaagttcaacgcattgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaaaagtcagggc
agcagcaagaggaaggctgttgtccctgggccagcagagcatcccctgcaatacaactat
actttctggtactcaagaagaacccccggctgtcccaccagttcacagagctttgaacag
attggcacctttgcctctgtggagcagttctggaggttttatagccacatggtacatccc
agggacctgacaggccacagtgacttccgtctcttcaaagaaggagttaagcccatgtgg
gaggatgatgcaaataaaaatggtggcaagtggattattcgactgcagaagggcttgaca
tcccgttgctgggagaatctcatcctggccatgttgggggaacagttcatggttggggag
gagatctgtggggctgtgatctctgtccagtttcaggaggacattatttcaatatggaat
aagacttccagtgaccaagcaaccacagcccgcatccgagatacccttcggtga

KEGG   Vulpes vulpes (red fox): 112932657
Entry
112932657         CDS       T05911                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E isoform X1
  KO
K03259  translation initiation factor 4E
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp03013  RNA transport
vvp04066  HIF-1 signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04211  Longevity regulating pathway
vvp04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    112932657 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112932657 (EIF4E)
   04151 PI3K-Akt signaling pathway
    112932657 (EIF4E)
   04150 mTOR signaling pathway
    112932657 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112932657 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    112932657 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112932657 (EIF4E)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     112932657 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112932657 (EIF4E)
Translation factors [BR:vvp03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    112932657 (EIF4E)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 112932657
NCBI-ProteinID: XP_025871422
UniProt: A0A3Q7UDZ0
LinkDB
Position
Unknown
AA seq 238 aa
MLGKTRKTACYLNFVAWCLTIFLIPNCETTPTPNPPPTEEEKTESNQEVANPEHYIKHPL
QNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIE
PMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAK
GDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 717 nt   +upstreamnt  +downstreamnt
atgttagggaagactaggaagactgcttgttatcttaactttgttgcatggtgtctaaca
atctttctgataccaaactgtgaaaccacccctactcctaatcccccgcctacagaagaa
gagaaaacagaatctaaccaggaggttgctaacccagaacactatattaaacatccttta
cagaacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaac
cttcggctgatctctaagtttgatactgttgaagacttttgggctctgtacaaccacatc
cagttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgag
cctatgtgggaagatgagaaaaacaaacgaggaggacgatggctaattacattgaacaag
cagcagagacgtagtgacctggatcgcttttggctagagacactgctgtgccttattgga
gaatcttttgatgactacagtgatgatgtatgtggagctgttgttaatgttagagctaaa
ggtgataagatagcaatatggactactgaatgtgaaaacagagaggctgttacacatata
gggagggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcc
catgcagacacagctacaaagagcggctccactactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system