KEGG   Vulpes vulpes (red fox): 112917033
Entry
112917033         CDS       T05911                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04151  PI3K-Akt signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04640  Hematopoietic cell lineage
vvp04657  IL-17 signaling pathway
vvp04658  Th1 and Th2 cell differentiation
vvp04659  Th17 cell differentiation
vvp04660  T cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04672  Intestinal immune network for IgA production
vvp05140  Leishmaniasis
vvp05200  Pathways in cancer
vvp05310  Asthma
vvp05320  Autoimmune thyroid disease
vvp05321  Inflammatory bowel disease
vvp05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112917033 (IL4)
   04151 PI3K-Akt signaling pathway
    112917033 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112917033 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112917033 (IL4)
   04660 T cell receptor signaling pathway
    112917033 (IL4)
   04658 Th1 and Th2 cell differentiation
    112917033 (IL4)
   04659 Th17 cell differentiation
    112917033 (IL4)
   04657 IL-17 signaling pathway
    112917033 (IL4)
   04664 Fc epsilon RI signaling pathway
    112917033 (IL4)
   04672 Intestinal immune network for IgA production
    112917033 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112917033 (IL4)
  09163 Immune disease
   05310 Asthma
    112917033 (IL4)
   05320 Autoimmune thyroid disease
    112917033 (IL4)
   05321 Inflammatory bowel disease
    112917033 (IL4)
   05330 Allograft rejection
    112917033 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    112917033 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112917033 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112917033 (IL4)
Cytokines and growth factors [BR:vvp04052]
 Cytokines
  Interleukins
   112917033 (IL4)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Haparin
  Cytokines
   112917033 (IL4)
SSDB
Motif
Pfam: IL4 Ribosomal_S19e DUF5844
Other DBs
NCBI-GeneID: 112917033
NCBI-ProteinID: XP_025850654
UniProt: A0A3Q7RYM4
LinkDB
Position
Unknown
AA seq 132 aa
MGLTSQLIPTLVCLLALTSTFVHGHNFNITIKEIIKMLNILTARNDLCMELTVKDVFTAP
KNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEVKKSTLKDFLER
LKVIMQKKYYRL
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgattccaactctggtctgcttactagcactcaccagcacc
ttcgtccacggacataacttcaatattactattaaagagatcatcaaaatgttgaacatc
ctcacagcgagaaacgacttatgcatggagctgaccgtcaaggacgtcttcactgcccca
aagaacacaagcgataaggaaatcttctgcagagctgctactgtactgcggcagatctat
acacacaactgctccaacagatatctcagaggactctacaggaacctcagcagcatggca
aacaagacctgttctatgaatgaagtcaagaagagtacactgaaagacttcttggaaagg
ctaaaagtgatcatgcagaagaaatactacaggctctga

DBGET integrated database retrieval system