KEGG   Vulpes vulpes (red fox): 112917134
Entry
112917134         CDS       T05911                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04114  Oocyte meiosis
vvp04115  p53 signaling pathway
vvp04218  Cellular senescence
vvp04914  Progesterone-mediated oocyte maturation
vvp05166  Human T-cell leukemia virus 1 infection
vvp05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112917134 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112917134 (CCNB2)
   04114 Oocyte meiosis
    112917134 (CCNB2)
   04115 p53 signaling pathway
    112917134 (CCNB2)
   04218 Cellular senescence
    112917134 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112917134 (CCNB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112917134 (CCNB2)
   05170 Human immunodeficiency virus 1 infection
    112917134 (CCNB2)
DNA replication proteins [BR:vvp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112917134 (CCNB2)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112917134 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112917134
NCBI-ProteinID: XP_025850804
UniProt: A0A3Q7RZ12
LinkDB
Position
Unknown
AA seq 550 aa
MTTKRVLTTPPIRLRRCPPPGQWEEHAAAGRPMGARAARHLNPVTRRPREGPRRCGQECG
PAAARQLVSSRAGLAFLPAPCFAHGAAPTPDGECARPGRGARAAPPASSSLLRGASWSQR
ARLSASARLPAASAPGPRVLRPLPARGGGSLHIHLPKFYIWVSTDLENVDTGVNSKAKSH
VTIRRAVLEEIGNRVTTRATQVAKKAQNTKIPVQLTKTNVNKQLKPTASVKPVQMEMLAP
KGPPPALEEISMKEENLCQAFSDALLCKIEDIDHEDWENPQLCSDYVKDIYQYLRQLEVL
QSINPHFLDGREINGRMRAILVDWLVQVHSKFRLLQETLYMCIAVMDRFLQVQLVSRKKL
QLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLH
FLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQRILGQGKWNLK
QQYYTGYTENELLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISTIPQLNSKAIQ
ELASPLMGRS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgacaaccaaacgggtcttgacaaccccgccaatccgcctgcggcgctgcccgccgcct
ggccaatgggaggagcacgccgcggccggccgcccaatgggggcgcgagcggcgcggcat
ttgaatcccgtcactcggcgacctcgcgaaggtccccggcggtgcgggcaggagtgcggg
ccggcggcggcgcggcagctggtgtcctcccgggccggcctggccttcctgcctgcccct
tgcttcgcccatggcgctgctccgacgcccgacggtgagtgcgcccggccggggcgcggg
gctcgggccgcgcctccagcctcctcctcccttctgcgcggggcctcttggtcccaacgg
gcccggctctcggcttctgcccgcctccctgcggcgtccgcgccggggccccgcgtcctc
cggccgctcccagcgcggggcggggggtcactgcatattcaccttcccaaattctacatt
tgggtgtccactgatttggagaatgttgacactggagttaattctaaagctaagagtcat
gtgacaatcagacgggcagttttagaagaaattggaaatagagttacaaccagagccaca
caagtagctaagaaagctcagaacaccaaaatacctgttcaactcaccaaaacaaatgtc
aacaaacaactgaaacctactgcttctgtgaaaccagtacagatggaaatgttggctcca
aagggtcctccgccggccctggaggagatctccatgaaggaagagaacctctgccaagct
ttctctgatgccttgctctgcaaaattgaggacattgatcacgaggactgggaaaaccct
cagctctgcagtgactatgttaaggatatctaccagtatctacggcagcttgaggttctg
cagtccataaatccacacttcttagatggaagagagataaacggacgcatgcgcgccatc
ctggtggactggctggtgcaagtccactccaagtttaggctgctgcaggagactctgtac
atgtgcatcgccgtcatggaccgatttttacaggttcagctggtttctcgtaagaagctt
cagctggttgggattacagctctgctcttggcttccaagtatgaggagatgttttctcca
aatattgaagacttcgtttacatcacagacaatgcttataccagttcccagatccgagaa
atggaaacactgattttgaaagaactgaaatttgagctgggtcgacctttgccactgcat
ttcttaagacgggcatcaaaagctggggaggttgatgtggaacagcatactttagccaaa
tatctcatggagctgactctcatcgactatgacatggtgcattatcacccttcaaaggtg
gcagcggctgcttcctgcctgtcccaaaggattctgggccaaggaaaatggaacttaaag
cagcagtattatactggatacacagagaatgaactattggaagtcatgcagcacatggcc
aaaaatgtagtgaaagttaatgaaaacttaacgaaattcatcgccatcaagaataagtat
gcaagcagcaaactcctgaagatcagcacaattcctcagctgaactcaaaagccatccaa
gagcttgcctcgcctctgatgggacggtcgtag

KEGG   Vulpes vulpes (red fox): 112921925
Entry
112921925         CDS       T05911                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B1-like
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04114  Oocyte meiosis
vvp04115  p53 signaling pathway
vvp04218  Cellular senescence
vvp04914  Progesterone-mediated oocyte maturation
vvp05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112921925
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112921925
   04114 Oocyte meiosis
    112921925
   04115 p53 signaling pathway
    112921925
   04218 Cellular senescence
    112921925
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112921925
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112921925
DNA replication proteins [BR:vvp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112921925
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112921925
SSDB
Motif
Pfam: Cyclin_C Cyclin_N Trypan_PARP
Other DBs
NCBI-GeneID: 112921925
NCBI-ProteinID: XP_025857089
UniProt: A0A3Q7SAY3
LinkDB
Position
Unknown
AA seq 378 aa
MALRVTRNTKVNVENEAKIGMAGAKRVPLASAAASKPSPRPRTALGDVGNKVSEQPQAKL
PLKKEAKTLVPGKVIAKKIPKPLEKAPEPVPVPVPEPELEPEPVKEEKLSPEPILVDTPS
PSPMETSGCAPAEEYLCQAFSDVILAVNVVDAEGGADPNLCREYAKDIYAYLRQLEEEQA
NNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRSLNF
YMGRPLPLHFLWRASKIGEVDVEQHTLAKYPMEQSMLDYDMVHFPPSQIAAGAFCLALKI
LDNGEWTPTLQHYLSYIEESHLNVMQHLAKNIVMVNCGLIKHMTIKNKYATSKHANISTL
AQLNSAVVQDLAKAVAKV
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcgctccgggtcaccaggaacacaaaagttaatgttgaaaacgaggcgaagatcggt
atggcaggggcgaagcgggtgcctctggcctctgctgcagcctccaagcccagcccgagg
ccaagaactgctctgggagacgttggtaacaaagtcagtgaacaaccacaggccaaactg
cctctgaaaaaggaagcaaaaactttggttcctggaaaagtcatcgctaaaaaaatacca
aagcctctggagaaggcacctgagcctgtccctgtccctgtgccagaaccagagctggaa
cctgagccagttaaagaagaaaaactttcgcctgagcctatattggttgatactccctct
ccaagcccgatggaaacatctggatgtgcccctgcagaagagtatctgtgtcaggctttc
tctgatgtaattcttgcagtgaatgttgtagatgcagaaggtggagctgatccaaacctt
tgtagggaatatgcgaaagatatttatgcttatctgagacaacttgaggaagagcaagca
aataactgtgtgcccaagaagatgctgcagctggttggtgtcactgccatgtttattgca
agcaaatatgaggaaatgtaccctccagaaattggtgactttgcctttgtgactgacaac
acttacactaaacaccaaatcagacagatggaaatgaagattctaagatctttaaatttt
tatatgggccgccctctacccctgcatttcctctggagagcgtctaagataggagaggtt
gatgttgagcaacatactttggccaaatatccgatggaacaatctatgttggactacgat
atggtacactttcctccttctcagattgcagcaggagctttttgcttagcgctgaaaatt
ctcgataatggtgaatggacaccaactctacagcattatctgtcatacatcgaagaatcc
catctaaatgttatgcaacacctggctaagaatatagtcatggtgaattgtgggcttata
aagcacatgactatcaagaacaagtatgccacctctaagcatgctaatatcagcactctg
gcacagctaaattctgcagtagttcaagatttagccaaggctgtggcaaaggtgtaa

KEGG   Vulpes vulpes (red fox): 112935841
Entry
112935841         CDS       T05911                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04114  Oocyte meiosis
vvp04115  p53 signaling pathway
vvp04218  Cellular senescence
vvp04914  Progesterone-mediated oocyte maturation
vvp05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112935841 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112935841 (CCNB1)
   04114 Oocyte meiosis
    112935841 (CCNB1)
   04115 p53 signaling pathway
    112935841 (CCNB1)
   04218 Cellular senescence
    112935841 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112935841 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112935841 (CCNB1)
DNA replication proteins [BR:vvp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112935841 (CCNB1)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112935841 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DOCK_N
Other DBs
NCBI-GeneID: 112935841
NCBI-ProteinID: XP_025875563
UniProt: A0A3Q7U0S1
LinkDB
Position
Unknown
AA seq 427 aa
MALRVTRNTKVNVENKAKIGMAGAKRVPLASAAASKPGLRPRTALGDIGNKVSEQPQAKL
PLKKEAKTAVPGKVIAKKIPKPLEKAPEPVPVPVPEPELEPESVKEEKLSPEPILVDTPS
PSPMETSGCAPAEEYLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQA
VKPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQL
VGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRSLNFGLGRPLPLHFL
RRASKVGEVDVEQHTLAKYLMELSMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQ
HYLSYTEESLLNVMQHLAKNIVMVNRGLTKHMTIKNKYAASKHAKISTLAQLNSALVQDL
AKAVAKV
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcgctccgggtcaccaggaacacaaaagtgaatgttgaaaacaaggcgaagatcggt
atggcaggggcgaagcgggtgcctctggcctctgctgcagcctccaagcccggcctgagg
ccaagaactgctctgggagacattggtaacaaagtcagtgaacaaccacaggccaaactg
cctctgaaaaaggaagcaaaaactgcggttcctggaaaagtcattgctaaaaaaatacca
aagcctctggagaaggcacctgagcctgtccctgtccctgtgccggaaccagagctggaa
cctgagtcggttaaagaagaaaaactttcgcctgagcctattttggttgatactccctct
ccaagcccgatggaaacatctggatgtgctcctgcagaagaatatctgtgtcaggctttt
tctgatgtaattcttgcggtgaatgatgtagatgcagaagatggagctgatccaaacctt
tgtagtgaatacgtgaaagatatttatgcttatctgagacaacttgaggaagaacaagca
gtcaaaccaaaatacctactaggtcgtgaagtcactggaaacatgagagccatcctaatt
gactggctagtacaggttcaaatgaaattcaggttactgcaggagaccatgtacatgact
gtttccattattgatcggttcatgcagaataactgtgtgcccaagaagatgctgcagctg
gttggtgtcactgccatgtttattgcaagcaaatatgaggaaatgtaccctccagaaatt
ggtgactttgcctttgtgactgacaacacttacactaaacaccaaatcagacagatggaa
atgaagattctaagatctttaaattttggtctgggccgccctctacccctgcatttcctt
cggagagcgtctaaggttggagaggttgatgttgagcaacatactttggccaaatacctg
atggagctatctatgttggactacgatatggtacactttcctccttctcagattgcagca
ggagctttttgcttagcgctgaaaattctcgataatggtgaatggacaccaactctacag
cattatctgtcctacactgaagaatcccttctaaatgtcatgcaacacctggctaagaat
atagtcatggtgaatcgtgggcttacaaagcacatgactatcaagaacaagtatgctgcc
tctaagcatgctaagatcagcactctggcacagctaaattctgcactagttcaagattta
gccaaggctgtggcaaaggtgtaa

DBGET integrated database retrieval system