KEGG   Vulpes vulpes (red fox): 112917274
Entry
112917274         CDS       T05911                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04012  ErbB signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04151  PI3K-Akt signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04934  Cushing syndrome
vvp05162  Measles
vvp05165  Human papillomavirus infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05203  Viral carcinogenesis
vvp05206  MicroRNAs in cancer
vvp05215  Prostate cancer
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112917274 (CDKN1B)
   04066 HIF-1 signaling pathway
    112917274 (CDKN1B)
   04068 FoxO signaling pathway
    112917274 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    112917274 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112917274 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112917274 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    112917274 (CDKN1B)
   05206 MicroRNAs in cancer
    112917274 (CDKN1B)
   05203 Viral carcinogenesis
    112917274 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    112917274 (CDKN1B)
   05220 Chronic myeloid leukemia
    112917274 (CDKN1B)
   05215 Prostate cancer
    112917274 (CDKN1B)
   05222 Small cell lung cancer
    112917274 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112917274 (CDKN1B)
   04934 Cushing syndrome
    112917274 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    112917274 (CDKN1B)
   05169 Epstein-Barr virus infection
    112917274 (CDKN1B)
   05165 Human papillomavirus infection
    112917274 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112917274 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112917274
NCBI-ProteinID: XP_025850985
UniProt: A0A3Q7T7S5
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGTRQAGPFLG
SQANSEDTHLVDPKTDAPDSQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctcgagcggatggacgccagacag
gccgagtaccccaagccctccgcctgcaggaacctcttcggcccggtcaaccacgaagag
ttgacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaggaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagagccaggacgtcagcgggacccgccaggcggggcctttcctgggg
tctcaggctaactcagaggacacacacttggtagacccaaagactgatgcgcccgacagc
cagacggggctagcggagcagtgcaccgggataaggaagcgacccgcgaccgacgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaacgtctcagacggttccccgaac
gcgggttcagtggagcagacgcccaagaagccgggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system