KEGG   Vulpes vulpes (red fox): 112917426
Entry
112917426         CDS       T05911                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04020  Calcium signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04260  Cardiac muscle contraction
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04270  Vascular smooth muscle contraction
vvp04713  Circadian entrainment
vvp04720  Long-term potentiation
vvp04723  Retrograde endocannabinoid signaling
vvp04724  Glutamatergic synapse
vvp04725  Cholinergic synapse
vvp04726  Serotonergic synapse
vvp04727  GABAergic synapse
vvp04728  Dopaminergic synapse
vvp04742  Taste transduction
vvp04911  Insulin secretion
vvp04912  GnRH signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04924  Renin secretion
vvp04925  Aldosterone synthesis and secretion
vvp04927  Cortisol synthesis and secretion
vvp04929  GnRH secretion
vvp04930  Type II diabetes mellitus
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp05010  Alzheimer disease
vvp05020  Prion disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05031  Amphetamine addiction
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112917426 (CACNA1C)
   04020 Calcium signaling pathway
    112917426 (CACNA1C)
   04024 cAMP signaling pathway
    112917426 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    112917426 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112917426 (CACNA1C)
   04929 GnRH secretion
    112917426 (CACNA1C)
   04912 GnRH signaling pathway
    112917426 (CACNA1C)
   04921 Oxytocin signaling pathway
    112917426 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    112917426 (CACNA1C)
   04924 Renin secretion
    112917426 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    112917426 (CACNA1C)
   04927 Cortisol synthesis and secretion
    112917426 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112917426 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    112917426 (CACNA1C)
   04270 Vascular smooth muscle contraction
    112917426 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    112917426 (CACNA1C)
   04727 GABAergic synapse
    112917426 (CACNA1C)
   04725 Cholinergic synapse
    112917426 (CACNA1C)
   04728 Dopaminergic synapse
    112917426 (CACNA1C)
   04726 Serotonergic synapse
    112917426 (CACNA1C)
   04720 Long-term potentiation
    112917426 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    112917426 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    112917426 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112917426 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112917426 (CACNA1C)
   05020 Prion disease
    112917426 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    112917426 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    112917426 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112917426 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112917426 (CACNA1C)
   05414 Dilated cardiomyopathy
    112917426 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112917426 (CACNA1C)
   04934 Cushing syndrome
    112917426 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:vvp04040]
    112917426 (CACNA1C)
Ion channels [BR:vvp04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112917426 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 112917426
NCBI-ProteinID: XP_025851276
UniProt: A0A3Q7S8P9
LinkDB
Position
Unknown
AA seq 2140 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEIVEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNP
ENTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEEN
SRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQ
VFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNS
TEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELD
KAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAANSQGDA
ESPSHEKLVDSTFTPSSYSSTGSNANINNANNTGLGRFPPPSGYPGAASTAEGHGTPLSP
AGRVQEAAWKLSSKRCHSRESQIAMVCQEEVSQDETYDVKMSEDAEYCSEPSLISTEMLS
YQDDENRQLTPPEEDKRDVRQSPKRGFLRSASLGRRASFHLECLKRQKNQGGDISQKTVL
PLHLVHHQALAVAGLSPLLQRSHSPGTLPRPCATPPATPGSRGWPPQPIPTLRLEGAESN
EKLNSSFPSIHCSSWSEEPTPCGGGDSTIRRARPVSLTVPSQAGARGRQFHGSASSLVEA
VLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVN
CRDPGQDKAGGHEGDACTAALACQKSEEELQDSRAHTGSL
NT seq 6423 nt   +upstreamnt  +downstreamnt
atggtcaatgagaacacgaggatgtacattccggaggaaaaccaccaaggttccaactat
gggagcccacgcccagctcatgccaacatgaacgccaatgcagctgcgggactcgcccct
gagcacatccccacgccgggtgcggccttgtcttggcaggcggccatcgacgcagcccgg
caggccaagctgatgggcagcgccggcaacgcgaccatttccacggtcagctccacgcag
cggaagcggcagcagtatgggaaacccaagaagcagggcagcacaacggccacgcgccca
ccccgcgccctactttgcctgactctgaagaaccccatccggagggcgtgcatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattccctttccagaagacgactccaatgccaccaattccaacctggaa
cgagtggaatatctctttctcataatttttactgtggaagcatttttaaaagtaatagcc
tatggacttctctttcaccccaacgcttacctccgcaatggttggaatttactagatttt
ataattgtggttgtagggcttttcagtgcaattttggaacaagcaaccaaagccgatggg
gcaaatgctctaggaggaaaaggagctggatttgacgtgaaggcgctgagagcattccgt
gtgctgcgccccttgaggctggtgtctggagtcccaagtctccaggtggttctgaattcc
attatcaaggccatggtgcccctgctgcatattgccctgttagtgctgtttgtcattatc
atctatgccataatcggcttggagctcttcatggggaaaatgcataagacctgctacaac
caggaaggcatagcagatgttccagcagaagatgatccttccccttgtgctctggagaca
ggccatgggcggcagtgccagaatggcactgtgtgcaagcccgggtgggatgggcccaag
catggcatcaccaactttgacaattttgccttcgccatgttgacggtattccagtgcatc
accatggagggctggacagatgtgctgtactggatgcaggacgctatgggctatgagtta
ccctgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctggtt
ctcggtgtgttgagcggagagttttccaaagagagggagaaggccaaagctcggggcgat
ttccagaagcttcgagagaagcagcagctggaagaggacctaaagggctacctggactgg
atcacccaggcagaggacatcgaccctgagaatgaggatgaaggcatggatgaggagaag
ccccgaaacatgagcatgcccacaagcgagaccgagtctgtcaacaccgaaaacgtggct
ggaggtgacatcgagggagagaactgcggggccagactggcccaccggatttctaaatca
aagttcagccgctactggcgccggtggaatcggttctgcagaagaaagtgtcgtgctgca
gtcaagtctaatgtcttctactggcttgtgatcttcctggtgtttctcaacacactcacc
atcgcctcagaacactacaatcagccccactggctcacagaggtccaagacacggccaac
aaggcactactggccctttttacggcagagatgctgctgaagatgtatagcctgggcctg
caggcctactttgtgtccctcttcaaccgcttcgactgcttcatcgtgtgtgggggcatc
ctggagaccatcctggtggagaccaagatcatgtctcccttgggcatctctgtgctgaga
tgtgtccggctcctacggatatttaaaatcacaagatactggaactccttaagcaacctg
gtggcatccttgctgaattctgtgcgttccatcgcctccctgctgctactcctctttctc
ttcatcatcatcttctccctcctggggatgcagctctttggaggaaagttcaactttgat
gaaatgcagactcggaggagcacatttgataactttccacagtccctcctcaccgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aactatatcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgag
agcctcacatctgcccaaaaggaggaggaagaagagaaagagagaaagaagctggccagg
actgccagcccagagaagaaacaagagatagtggagaagccagcagtggaggaaaccaag
gaggaaaaaattgaactgaaatccattacagctgatggagagtccccacccaccactaag
atcaacatggatgacctccagcccaatgaaaatgaggataagagtccctaccccaaccca
gaaaatacaggagaagaggatgaggaggagcctgagatgcctgtgggcccccgcccacga
ccactctctgagctgcaccttaaggaaaaggcagtgcccatgccagaagccagtgcattt
ttcatcttcagccccaacaacagatttcgcctccagtgccaccgcattgtcaatgacacg
atcttcaccaacctgatcctcttcttcattctgctcagcagcatttccctagcagctgaa
gatcccgtccagcacacctccttcaggaaccatatcctaggcaatgcagactatgtcttc
actagtatctttacattagaaattatccttaagatgactgcttatggggctttcctacat
aagggctctttttgccggaactacttcaacatcttggacctgttggtggtcagcgtgtcc
ctcatttcctttggcatccagtccagtgcaatcaatgtggtgaagattttacgagttttg
cgagtcctcaggcccctgagggccatcaacagggccaagggactaaagcacgtggttcag
tgcgtgttcgtcgccatccggactatcgggaacatcgtgattgtcaccacactgcttcaa
ttcatgttcgcctgcattggggtccagcttttcaagggaaagctctacacctgttcagat
agttccaaacagaccgaggcggaatgcaagggtaactacatcacatacaaggacggggag
gttgaccaccccatcatccaaccccgcagctgggagaacagcaagtttgactttgacaat
gttctggcagccatgatggccctttttactgtctctacctttgaagggtggccagagctg
ctgtaccgctccatcgactcccacacagaagacaagggccccatctacaactaccgtgtg
gagatctccatctttttcatcatctacatcatcatcattgccttcttcatgatgaacatc
ttcgtgggtttcgttatcgtcaccttccaggagcagggggagcaggaatacaagaactgt
gagctggacaagaaccagcgacagtgcgtggaatatgccctcaaggcccggcccctgcgg
aggtacatccccaagaaccagcaccagtacaaagtgtggtatgtggtcaactccacctac
tttgaatacctgatgttcgtcctcatcctgctcaacaccatctgcttggccatgcagcac
tatggccagagctgcctattcaaaattgccatgaacatcctcaacatgctcttcactggc
ctcttcaccgtggagatgattctgaagctcattgccttcaaacccaagcactatttctgt
gatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatc
accgaggtaaacccagctgaacatacccaatgctctccctttatgaatgcagaggagaac
tcccgcatctccatcaccttcttccgcctcttccgggtcatgcgcctggtcaagctgctg
agccgaggggagggcatccggaccctgctgtggaccttcatcaaatccttccaggccctg
ccttacgtggctcttctgatagtgatgttgttcttcatctatgcggtgattgggatgcag
gtgtttgggaagattgccctgaatgacaccacagagatcaatcggaacaacaacttccag
accttcccccaagctgtgctgcttctcttcaggtgtgccacaggggaggcatggcaggac
atcatgctggcctgcatgccagggaagaagtgtgcccccgagtcggagcccagcaacagc
acagaaggtgaaacaccctgtggcagcagcttcgcagtcttctacttcatcagcttctac
atgctctgtgccttcctgatcattaacctctttgtagctgtcatcatggataactttgac
tacctgacaagggactggtcaattcttggtccccatcatctggatgaatttaaaagaatc
tgggcagagtatgatcctgaagccaagggtcgaatcaaacacctagatgtagtgaccctg
ctccggcggattcagcccccactgggttttgggaagctgtgccctcaccgtgtggcttgc
aaacgtctagtctccatgaacatgcctctgaacagtgatgggacggtcatgttcaatgcc
accctgtttgccctggtccggacagccctgcggatcaaaacagaagggaacctagaacaa
gccaacgaggagctgcgggccataatcaagaagatctggaagcgaaccagcatgaaactg
ctggaccaagtggtgcctccagcgggtgatgatgaggtcacggttggcaagttttatgct
actttcctgatccaagagtacttccggaaattcaagaagcgcaaagaacagggcctggtg
ggcaagccttcccagaggaacgccctatccctgcaggctggcttgcgcacgctgcatgac
atcgggcctgagatccgacgggccatctctggagatctgacggctgaggaggagctggac
aaggccatgaaggaggctgtgtctgctgcctctgaagacgacatcttcaggagggccggt
ggcctgttcggcaaccacgtcagctactaccaaagcgatggcaggagcgccttcccccag
accttcaccacccagcgcccactgcacatcaataaggcggccaacagccaaggcgatgcc
gagtcaccatcccacgagaaactggtggactccactttcacccccagcagctactcgtcc
accggctcgaatgccaacatcaacaacgccaacaacactggcctgggccgcttccccccg
ccctctggctaccctggcgctgccagcaccgccgagggccacggaacccccctgtctcct
gccggccgggtgcaggaggctgcatggaagctcagctccaagaggtgccactcccgggag
agccagatagccatggtgtgtcaggaggaggtctctcaggatgagacctatgacgtgaag
atgagcgaagacgccgagtactgcagtgagcccagcctgatctccacagagatgctctcc
tatcaggatgatgaaaatcggcaattaacaccacctgaagaagacaagagggacgtccgg
caatctccaaagaggggtttcctccgctctgcctccctgggtcgaagggcctccttccac
ctggaatgtctgaagcgacagaagaatcaagggggagacatctctcagaagacagtcctg
cccttgcacctggttcatcaccaggcattggcagtggcaggcctgagccccctcctccag
agaagccattcccctggcacgctccccaggccatgtgccacccccccagccacacccggc
agccgaggctggcccccgcagcctatccccaccctgcggctggagggggctgagtccaac
gagaaactcaacagcagcttcccgtccatccactgcagctcctggtctgaggagcccaca
ccctgtggaggaggtgacagcaccatccggagagcccggccggtgtccctcactgtgccc
agccaggctggggcccggggcaggcagttccatggcagtgccagcagcctcgtggaagcg
gtcttgatttcagaaggactggggcagtttgctcaagatcccaagtttatcgaggtcaca
acccaggagctggctgacgcctgtgacatgaccatagaggagatggagaacgccgctgac
aacatcctcagtgggggcgcccagcagagccccaacggcaccctcctaccttttgttaac
tgcagggaccccgggcaggacaaagcggggggtcacgagggcgacgcctgcacggccgcc
ctggcatgtcagaagagcgaggaagagctccaggacagcagagcccacaccggcagcctg
tag

DBGET integrated database retrieval system