KEGG   Vulpes vulpes (red fox): 112917438
Entry
112917438         CDS       T05911                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04071  Sphingolipid signaling pathway
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp04217  Necroptosis
vvp04650  Natural killer cell mediated cytotoxicity
vvp04932  Non-alcoholic fatty liver disease
vvp05010  Alzheimer disease
vvp05014  Amyotrophic lateral sclerosis
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112917438 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112917438 (BID)
   04215 Apoptosis - multiple species
    112917438 (BID)
   04217 Necroptosis
    112917438 (BID)
   04115 p53 signaling pathway
    112917438 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112917438 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112917438 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112917438 (BID)
   05014 Amyotrophic lateral sclerosis
    112917438 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    112917438 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112917438 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112917438 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112917438 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112917438 (BID)
   05161 Hepatitis B
    112917438 (BID)
   05160 Hepatitis C
    112917438 (BID)
   05164 Influenza A
    112917438 (BID)
   05162 Measles
    112917438 (BID)
   05168 Herpes simplex virus 1 infection
    112917438 (BID)
   05163 Human cytomegalovirus infection
    112917438 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112917438 (BID)
   05169 Epstein-Barr virus infection
    112917438 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112917438 (BID)
SSDB
Motif
Pfam: BID APH Bcl-2
Other DBs
NCBI-GeneID: 112917438
NCBI-ProteinID: XP_025851298
UniProt: A0A3Q7S5Z1
LinkDB
Position
Unknown
AA seq 204 aa
MESKVSNGSGPQDERITNLLVFGFLQNCSNYNFHEELELLGRELPVPAYLKEDHDDELQT
DGNRCSYFLDGGARDSESQEEIIQDIARQLAQIGDRMDHSIHPGLVNNLAMQFMNVNLSE
EDRRKHLAAALEQAMQTYPKDMEKEKTMLMLAMLLAKKVADHTPSLLRDVFHTTVNFISQ
NLLTYVRNLVRNVRTSDVNSLLSH
NT seq 615 nt   +upstreamnt  +downstreamnt
atggagtctaaggtgagcaatggctcaggcccccaggatgagcgtatcaccaatttgcta
gtgtttggcttcctccaaaactgctccaactataatttccacgaagagttggagctgttg
ggccgagaactgcccgtgccagcttacctgaaggaggaccacgacgatgagctacagaca
gatggcaaccggtgcagctacttcctggatggtggggcgagagattccgaaagtcaagaa
gaaatcatccaggatatcgccaggcagctcgcccaaataggggacaggatggatcacagc
atccacccaggactggtgaataacctggcaatgcagtttatgaatgtgaacctatcggaa
gaagacagaaggaagcatcttgctgctgcgctggagcaggccatgcagacttatcctaag
gacatggaaaaggagaagaccatgctgatgttggccatgctgttggccaaaaaggtggcc
gatcacaccccatccttgctccgtgacgtctttcacacaacagtgaactttattagccag
aacctgctcacctatgtgaggaacttagtcagaaatgtaagaaccagtgatgtcaactcc
ttgctgtctcactaa

DBGET integrated database retrieval system