KEGG   Vulpes vulpes (red fox): 112917778
Entry
112917778         CDS       T05911                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04020  Calcium signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04520  Adherens junction
vvp04530  Tight junction
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05215  Prostate cancer
vvp05219  Bladder cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112917778 (ERBB2)
   04012 ErbB signaling pathway
    112917778 (ERBB2)
   04066 HIF-1 signaling pathway
    112917778 (ERBB2)
   04020 Calcium signaling pathway
    112917778 (ERBB2)
   04151 PI3K-Akt signaling pathway
    112917778 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112917778 (ERBB2)
   04520 Adherens junction
    112917778 (ERBB2)
   04530 Tight junction
    112917778 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112917778 (ERBB2)
   05206 MicroRNAs in cancer
    112917778 (ERBB2)
   05205 Proteoglycans in cancer
    112917778 (ERBB2)
   05230 Central carbon metabolism in cancer
    112917778 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112917778 (ERBB2)
   05226 Gastric cancer
    112917778 (ERBB2)
   05219 Bladder cancer
    112917778 (ERBB2)
   05215 Prostate cancer
    112917778 (ERBB2)
   05213 Endometrial cancer
    112917778 (ERBB2)
   05224 Breast cancer
    112917778 (ERBB2)
   05223 Non-small cell lung cancer
    112917778 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112917778 (ERBB2)
   01524 Platinum drug resistance
    112917778 (ERBB2)
   01522 Endocrine resistance
    112917778 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112917778 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112917778 (ERBB2)
   04090 CD molecules [BR:vvp04090]
    112917778 (ERBB2)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112917778 (ERBB2)
Protein kinases [BR:vvp01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112917778 (ERBB2)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   112917778 (ERBB2)
CD molecules [BR:vvp04090]
 Proteins
  112917778 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like CBP_BcsF
Other DBs
NCBI-GeneID: 112917778
NCBI-ProteinID: XP_025851542
UniProt: A0A3Q7RXN7
LinkDB
Position
Unknown
AA seq 1273 aa
MTLGSEWRAGVRLEKLTGQCPLTHVSLLPVCTGTDMKLRLPASPETHLDMLRHLYQGCQV
VQGNLELTYLPANASLSFLQDIQEVQGYVLIAHSQVRQIPLQRLRIVRGTQLFEDNYALA
VLDNGDPLEGGISAPGAAPGGLRELQLRSLTEILKGGVLIQRNPQLCHQDTILWKDVFHK
NNQLALTLIDTNRSRACPPCSPACKDAHCWGASSGDCQSLTRTVCAGGCARCKGPQPTDC
CHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASC
VTSCPYNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRA
VTSANIQEFAGCKKIFGSLAFLPESFEGDPASNTAPLQPEQLRVFEALEEITGYLYISAW
PDSLPNLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLRELGSGLALIHRNARLC
FVHTVPWDQLFRNPHQALLHSANRPEEECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFL
RGQECVEECRVLQGLPREYVKDRYCLPCHSECQPQNGSVTCFGSEADQCVACAHYKDPPF
CVARCPSGVKPDLSFMPIWKFADEEGTCQPCPINCTHSCADLDEKGCPAEQRASPVTSII
AAVVGILLAVVVGLVLGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRIL
KETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMA
GVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSY
LEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESIL
RRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIM
VKCWMIDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMG
DLVDAEEYLVPQQGFFCPEPTPGAGGTAHRRHRSSSTRVSVLCHTESGGGELTLGLEPSE
EEPPKSPLAPSEGAGSDVFDGDLGMGAAKGLQSLPSQDPSPLQRYSEDPTVPLPPETDGY
VAPLTCSPQPEYVNQPEVWPQPPSPLEGPLPPSRPAGATLERPKTLSPKTLSPGKNGVVK
DVFAFGSAVENPEYLAPRGRAAPQPHPPPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPT
AENPEYLGLDMPV
NT seq 3822 nt   +upstreamnt  +downstreamnt
atgactctagggagtgagtggagagcaggagtcaggttggagaagctcaccggccagtgc
cctctgacccatgtctccctcctaccagtgtgcaccggcacagacatgaagctccggctc
ccggccagtcccgagacccacctggatatgctccgccacctgtaccagggctgtcaagtg
gtacaggggaacctggagctcacttacctgcctgccaatgccagcctgtccttcctgcag
gatatccaggaggtgcagggctatgtgctcattgctcacagccaagtgaggcagatccca
ctgcagaggctacgaattgtgcgaggcacccagctctttgaggacaactacgccctggcc
gtgctggacaatggagacccactggagggtggcatctctgcaccaggggcggccccagga
gggctgcgggagctgcagcttcgaagcctcacagagatcctgaagggaggggtcttgatt
cagcggaacccgcagctctgccaccaggacacgattttatggaaggacgtcttccataag
aacaaccagctggccctcacgctgatagacaccaaccgctctcgggcctgcccaccctgt
tctccagcttgtaaagacgcccactgctggggggccagctccggggactgtcagagcttg
acgcggactgtctgtgcagggggctgtgcccgctgcaagggcccacaacccactgactgc
tgccacgagcagtgtgctgctggctgcacgggccccaagcactctgactgcctggcctgc
cttcacttcaaccacagtggcatctgtgagctgcactgcccagccctggtcacctacaac
acggacaccttcgaatccatgcccaaccctgagggccgatataccttcggggccagctgt
gtgacctcctgtccctacaactacctgtctacggacgtgggatcctgcaccctggtctgt
cccctgaacaaccaagaggtgacggctgaggatgggacacagcggtgcgagaaatgcagc
aagccctgtgcccgagtgtgctatggtctgggcatggagcacctgcgggaggtgagggcg
gtcaccagtgcgaacatccaggagtttgccggctgcaagaagatctttggaagcctggca
tttttgccagagagctttgagggggacccagcctccaacactgcccccctacagcctgag
cagctcagagtgtttgaggctctggaggagatcacaggttacctgtacatctcagcgtgg
ccagacagcctgcctaacctcagtgtcttccagaacctgcgagtaatccggggacgagtt
ctgcatgatggtgcctactcgttgaccctgcaagggctgggcatcagctggctggggctg
cgctcgctgcgggaactgggcagtgggctggccctcatccaccgcaacgcccgcctttgc
ttcgtgcacacggtgccctgggatcagctcttccggaacccccaccaggccctgctccat
agtgccaaccggccagaggaggagtgtgtgggcgagggcctggcctgctacccgctgtgc
gcccatgggcactgctggggtccagggcccacccagtgcgtcaactgcagccaattcctt
cggggccaggagtgcgtggaggaatgccgagtactgcaggggctgccccgagagtatgtg
aaggacaggtactgtctgccgtgccactcagagtgtcagccccagaatggctcagtgacc
tgctttggatcggaggctgaccagtgtgtggcctgcgcccactacaaggaccctcccttc
tgtgtggctcgctgccccagtggtgtgaaacctgacctgtccttcatgcccatttggaag
ttcgcagatgaggagggcacttgccagccgtgccccatcaactgcacccactcctgtgcg
gacctggacgagaagggctgtcccgctgagcagagagccagccctgtgacatccatcatt
gctgctgtggtgggcattctgctggctgtggtcgtggggctggtcctcggcatcctgatc
aagcgaaggcggcagaagatccggaagtacactatgcggaggctgctgcaggaaaccgag
cttgtggagccgctgacgcctagtggagcgatgcccaaccaggctcagatgcggatcctg
aaagagacagagctgaggaaggtgaaggtgcttggatccggagcttttggcacagtctac
aagggcatctggatccctgatggggaaaatgtgaaaatcccagtggccatcaaagtgttg
agggaaaacacatctcccaaagccaacaaagaaatcttggacgaagcatatgtgatggct
ggagtgggctctccgtatgtgtcccgcctcctgggcatctgcctgacatccacggtgcag
ctggtgacacagcttatgccctacggctgcctcttagaccatgtccgagaacaccgtggg
cgcctgggctcccaggacttgctgaactggtgtgtgcagattgccaaggggatgagctac
ttggaggatgtccggctggtgcacagggacctggctgcccggaatgtgctggtcaagagt
cccaaccatgtcaagattacagattttgggctggctcggttgctggacattgacgagaca
gagtaccacgcggatgggggcaaggtgcccatcaagtggatggcgctggagtccattctc
cgccggcggttcacccaccagagtgatgtgtggagctacggtgtgactgtgtgggaactg
atgacttttggggccaaaccttacgatgggatcccagcccgggagatccctgacctgctg
gagaagggggaacggctgccccagccccccatctgcaccattgatgtctacatgatcatg
gtcaagtgctggatgatagactctgaatgtcgaccccggttccgggagttggtggccgaa
ttctcgcgtatggccagggacccccagcgctttgtggtcattcagaatgaagacttgggc
cccgccagccccttggacagcaccttctaccgttcactactggaagatgatgacatgggg
gacctggtggatgctgaggagtacctggtaccccagcagggtttcttctgcccagaacct
accccaggggctgggggcactgcccaccgccggcaccgcagctcatccaccagggtcagt
gtcctctgtcacactgagagtggcggtggtgagctgactctaggactggagccctccgag
gaggaaccccccaagtctccactggcaccctcagagggcgctggctctgacgtgtttgat
ggtgacttgggaatgggggcagccaaggggctgcagagccttccctcacaggaccccagc
cctctccagcggtacagtgaggaccctacggtacccttgccccctgagactgatggctac
gtcgcccccctgacctgcagcccccagcctgaatatgtgaaccagccagaagtttggccg
cagcccccctcgcccctagaaggccctctgcctccttcccgaccggctggtgccactctg
gaaaggcccaagactctgtcccccaagactctctcccctggcaagaatggggttgtcaaa
gatgtttttgcctttgggagtgctgtggagaacccggagtacctggcaccccggggcaga
gctgcccctcagccccaccctcctccagccttcagcccagcctttgacaacctgtattac
tgggaccaggatccatcagagcggggctctccacccagcacctttgaagggacccctaca
gcagagaacccagagtacctggggctggacatgccagtgtga

DBGET integrated database retrieval system