KEGG   Vulpes vulpes (red fox): 112917940
Entry
112917940         CDS       T05911                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04012  ErbB signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04350  TGF-beta signaling pathway
vvp04371  Apelin signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04714  Thermogenesis
vvp04910  Insulin signaling pathway
vvp04931  Insulin resistance
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05221  Acute myeloid leukemia
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112917940 (RPS6KB1)
   04350 TGF-beta signaling pathway
    112917940 (RPS6KB1)
   04371 Apelin signaling pathway
    112917940 (RPS6KB1)
   04066 HIF-1 signaling pathway
    112917940 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    112917940 (RPS6KB1)
   04152 AMPK signaling pathway
    112917940 (RPS6KB1)
   04150 mTOR signaling pathway
    112917940 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112917940 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    112917940 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112917940 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    112917940 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    112917940 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    112917940 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112917940 (RPS6KB1)
   05205 Proteoglycans in cancer
    112917940 (RPS6KB1)
   05231 Choline metabolism in cancer
    112917940 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112917940 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112917940 (RPS6KB1)
   05212 Pancreatic cancer
    112917940 (RPS6KB1)
   05225 Hepatocellular carcinoma
    112917940 (RPS6KB1)
   05226 Gastric cancer
    112917940 (RPS6KB1)
   05221 Acute myeloid leukemia
    112917940 (RPS6KB1)
   05224 Breast cancer
    112917940 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112917940 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112917940 (RPS6KB1)
   05163 Human cytomegalovirus infection
    112917940 (RPS6KB1)
   05165 Human papillomavirus infection
    112917940 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112917940 (RPS6KB1)
   01522 Endocrine resistance
    112917940 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112917940 (RPS6KB1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112917940 (RPS6KB1)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   112917940 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 112917940
NCBI-ProteinID: XP_025851836
UniProt: A0A3Q7SA26
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
VEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaagtttgaaatttcggaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacggtcacacacacattttgtggaacaatagaatacatg
gcccctgagatcttgatgagaagcggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacctccgtttactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcggcttggagctggtcct
ggagatgctggagaagttcaagctcatccattcttcaggcatattaactgggaagaactg
ctggctcggaaggtggagccaccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttttgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaaattttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccggtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacagcaaatcctcagacacctgtggaatatccaatggaaacaagtgga
gtagagcagatggatgtgacaatgagtggggaagcttcagcaccacttccaatacgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagagcac
ctacgtatgaatctatga

KEGG   Vulpes vulpes (red fox): 112924182
Entry
112924182         CDS       T05911                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04012  ErbB signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04350  TGF-beta signaling pathway
vvp04371  Apelin signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04714  Thermogenesis
vvp04910  Insulin signaling pathway
vvp04931  Insulin resistance
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05221  Acute myeloid leukemia
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112924182 (RPS6KB2)
   04350 TGF-beta signaling pathway
    112924182 (RPS6KB2)
   04371 Apelin signaling pathway
    112924182 (RPS6KB2)
   04066 HIF-1 signaling pathway
    112924182 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    112924182 (RPS6KB2)
   04152 AMPK signaling pathway
    112924182 (RPS6KB2)
   04150 mTOR signaling pathway
    112924182 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112924182 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    112924182 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112924182 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    112924182 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    112924182 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    112924182 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924182 (RPS6KB2)
   05205 Proteoglycans in cancer
    112924182 (RPS6KB2)
   05231 Choline metabolism in cancer
    112924182 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112924182 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112924182 (RPS6KB2)
   05212 Pancreatic cancer
    112924182 (RPS6KB2)
   05225 Hepatocellular carcinoma
    112924182 (RPS6KB2)
   05226 Gastric cancer
    112924182 (RPS6KB2)
   05221 Acute myeloid leukemia
    112924182 (RPS6KB2)
   05224 Breast cancer
    112924182 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112924182 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112924182 (RPS6KB2)
   05163 Human cytomegalovirus infection
    112924182 (RPS6KB2)
   05165 Human papillomavirus infection
    112924182 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112924182 (RPS6KB2)
   01522 Endocrine resistance
    112924182 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112924182 (RPS6KB2)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112924182 (RPS6KB2)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   112924182 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 112924182
NCBI-ProteinID: XP_025860075
UniProt: A0A3Q7TXK2
LinkDB
Position
Unknown
AA seq 428 aa
MAAVFDLDLETEEGSEGEPEFSPSVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHT
RAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLA
EITLALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYM
APEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLTLPPYLTPDA
RDLVKKFLKRNPSQRIGGGPGDSADVQRHPFFRHINWDDLLARRIDPPFRPCLQSEEDVS
QFDTHFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNS
SPRTPVSPLKFSPFEGFRPSSGPPEPMEPPLPPLLPPPPPPPSSTAPLPIRPPSGTKKSK
RGRGRPGR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggcggccgtgtttgacctggacttggagacggaggaaggcagcgagggcgagccagag
ttcagcccctcggtgttccaagtccgaaaggtgcagggcaccaacttgggcaagatatat
gccatgaaagtcctgagaaaggccaaaattgtgcgcaacgccaaggacacagcacacacg
cgggctgaacggaacattctagagtcagtgaagcaccccttcattgtggaactggcctat
gccttccagactggtggcaaactctacctcatcctcgagtgcctcagtggcggtgagctt
ttcacgcatctggagcgagagggcatcttcctggaagacacagcctgtttctacctggca
gagatcaccctggccctgggacatctccactcccaaggcataatctaccgggacctcaaa
cctgagaacatcatgctcaacagtcagggccacatcaaactgacagactttggactctgc
aaagagtcgatccatgagggcgctgtcacccatactttctgtggcaccattgaatacatg
gcccctgagattctggtacgcagtggccacaaccgggctgtggactggtggagcctgggg
gccctgatgtatgacatgctcactggatcgccacccttcaccgcagagaaccggaagaaa
accatggacaagatcatcaaagggaaactgacgctgcccccctacctcaccccggatgcc
cgggaccttgtcaaaaagtttctgaagcggaatcccagccagcggatcgggggtggccca
ggggactctgctgatgtgcagaggcaccccttcttccggcacattaattgggatgacctc
ctggctcgccgcatagacccccctttcaggccctgtctgcagtcagaggaggacgtaagc
cagtttgacacccacttcacacggcagacaccagtggacagtccagatgatacggccctc
agtgagagtgccaaccaggccttcctgggcttcacatacgtggcaccttctgtcctggac
agcatcaaggagggcttctcattccagcccaagctacgctcccccaggcgcctcaacagt
agtccccggaccccagtcagccccctgaagttctcaccctttgagggattccggcccagc
tctggcccaccggagcccatggagccccctctacctcctctcctgccgccgccgccacca
ccaccatcgagcactgcccctctccccatccgacccccttcggggaccaagaagtctaag
aggggccgtgggcgccctgggcgctag

DBGET integrated database retrieval system