KEGG   Vulpes vulpes (red fox): 112917953
Entry
112917953         CDS       T05911                                 

Gene name
PPM1D
Definition
(RefSeq) protein phosphatase 1D
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112917953 (PPM1D)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112917953 (PPM1D)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    112917953 (PPM1D)
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 112917953
NCBI-ProteinID: XP_025851855
UniProt: A0A3Q7T9Y0
LinkDB
Position
Unknown
AA seq 605 aa
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPWPRRSLSQPSPPRPSPPAPAG
SEVPGKGPAAAAREARDPPPDAAASPAPGRCCRRRSSVAFFAVCDGHGGREAAQFAREHL
WGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVII
RGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSG
VNRVVWKRPRLSHNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHT
LDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQ
RMLRADNTSAIVICISPGVDSQGNFTNEDELFLNLTDSPSYNSQETCLMTPSPCSTPPVK
SLEEDPWPRLNSKDHVPALVRSNAFSENYLEVPAEIARGSVHATAIPSKDSEPLEENCTK
ALTLRIHDSLNNSLSVGLVPTNSTNTITDQKNLKMSTPGQMKAQEVERTPPANFKRTLEE
SNSGPLMKKHRRNGLTRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRK
TVCVC
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggcggggctgtactcgctgggagtgagcgtcttctccgaccagggcgggaggaagtac
atggaggacgttactcagatcgtggtggagcccgagccgacggctgaagaaaagccctgg
ccgcggcggtcgctctcgcagccgtcgcctccgcggccgtccccgccggctcccgctggc
agcgaagtcccggggaaaggcccagcggccgcagcccgagaggctcgcgaccctcccccg
gacgccgcggcctcgccagctcccgggcgctgctgccgccgccgctcctcagtggcattt
ttcgccgtgtgcgacgggcacggcgggcgggaggcggcacagtttgcccgggagcatttg
tggggtttcatcaagaagcagaagggattcacctcgtccgagccggcgaaggtttgcgct
gccatccgcaaaggcttcctcgcttgtcacctcgccatgtggaagaaactggcagaatgg
ccaaagacaatgacaggtcttcccagcacgtcagggacaactgccagtgtggtcatcata
cggggcatgaagatgtatgtagctcacgtgggtgactcaggggtggttcttggaattcag
gatgacccgaaggatgattttgtcagagctgtggaggtgacacaggaccataaaccagaa
cttcccaaggaaagagaacgaatcgaaggacttggtgggagtgtgatgaacaagtctggg
gtgaatcgtgtagtttggaaacgacctcggctctctcacaatggacctgttagaaggagc
acagttattgaccagattccttttctggcagtagcaagagcacttggtgatttgtggagt
tatgatttcttcagtggtgagtttgtggtgtcacctgaaccagacacgagtgtccacact
cttgacccccagaagcacaagtatattattttggggagtgatggactttggaatatgatt
ccaccgcaagatgccatctcaatgtgccaggaccaagaggagaaaaagtacttgatgggt
gagcatggacagtcttgtgccaaaatgcttgtgaatcgagcactaggccgctggaggcag
cgtatgcttcgagcagataatactagtgctatagtgatctgcatttctccaggtgtggac
agtcagggaaatttcaccaatgaagacgagctctttctgaacttgactgatagtccttcc
tataatagtcaggaaacctgcttgatgactccttccccatgttctacaccaccagtcaag
tcactggaggaggacccatggccaaggctgaactctaaggaccatgtacctgcccttgtt
cgtagtaatgccttctcagagaattatttagaagtcccagctgagatagctcgaggaagt
gtccatgcgacagccataccctcaaaagattcagagccacttgaagaaaattgcactaaa
gccctgactttaaggatacatgattctttgaataatagcctgtcagttggccttgtgcct
accaattcaacaaataccatcacggaccaaaaaaatttaaaaatgtcaactccaggtcaa
atgaaagcccaagaagttgaaagaacccctccagcaaactttaaaaggacattagaagaa
tccaactccggccctcttatgaagaagcatagacgaaatggtttaactcgaagtagtggt
gctcagcctgcaagcctccccacaacctcacagcgaaagaactctgttaaacttactatg
cgacgcagacttaggggccagaagaaaattggaaatcctttacttcatcagcacagaaaa
actgtttgtgtctgctga

DBGET integrated database retrieval system