KEGG   Vulpes vulpes (red fox): 112918856
Entry
112918856         CDS       T05911                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04110  Cell cycle
vvp04144  Endocytosis
vvp04218  Cellular senescence
vvp04350  TGF-beta signaling pathway
vvp04371  Apelin signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04659  Th17 cell differentiation
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05142  Chagas disease
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112918856 (SMAD2)
   04390 Hippo signaling pathway
    112918856 (SMAD2)
   04371 Apelin signaling pathway
    112918856 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112918856 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    112918856 (SMAD2)
   04218 Cellular senescence
    112918856 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112918856 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112918856 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112918856 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112918856 (SMAD2)
   05205 Proteoglycans in cancer
    112918856 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112918856 (SMAD2)
   05212 Pancreatic cancer
    112918856 (SMAD2)
   05225 Hepatocellular carcinoma
    112918856 (SMAD2)
   05226 Gastric cancer
    112918856 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    112918856 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112918856 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112918856 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112918856 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 112918856
NCBI-ProteinID: XP_025852858
UniProt: A0A3Q7SA21
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcatctatcctgccgttcactccgcctgttgtgaagaggctgctgggatggaagaaa
tcagccggtgggtccggaggagcaggcggcggagagcagaatggacaagaagaaaagtgg
tgtgagaaagcggttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctctggatggccgtctgcaagtgtctcatcgg
aaaggactaccacacgtgatatattgccgattgtggcgctggcctgaccttcacagtcac
catgaactcaaagcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttttgcctccggtattagtg
ccacggcacactgagatcctaacagaactgcctcctctggatgattatacccactccatt
ccagaaaacactaatttcccagcgggaatcgagccacagagtaattacattccagaaacg
ccccctcctggatatatcagtgaggatggagaaacaagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactatctcctactactctttccccagttaatcatagt
ttggatttgcagccagttacttactcagaacctgcattttggtgttcaatagcatattat
gaattaaaccagagggttggtgagaccttccacgcatcacagccctcactcactgtagac
ggtttcacagatccatccaactcagagaggttctgcctagggttgctctccaacgtcaac
cgaaatgcgactgtagaaatgacaagaagacatataggaagaggagtacgcttatattac
ataggtggagaggtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aactgtaaccagagatacggctggcaccctgcgacagtgtgtaaaattccaccaggctgt
aatctgaagatcttcaacaatcaggaatttgctgctctcctggctcagtctgttaatcag
ggttttgaagccgtgtatcagctaactagaatgtgtaccataagaatgagttttgtgaaa
ggatggggagcagaataccgaaggcagacggtaacgagcactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

KEGG   Vulpes vulpes (red fox): 112929830
Entry
112929830         CDS       T05911                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04144  Endocytosis
vvp04218  Cellular senescence
vvp04310  Wnt signaling pathway
vvp04350  TGF-beta signaling pathway
vvp04371  Apelin signaling pathway
vvp04390  Hippo signaling pathway
vvp04520  Adherens junction
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04659  Th17 cell differentiation
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05161  Hepatitis B
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05220  Chronic myeloid leukemia
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112929830 (SMAD3)
   04350 TGF-beta signaling pathway
    112929830 (SMAD3)
   04390 Hippo signaling pathway
    112929830 (SMAD3)
   04371 Apelin signaling pathway
    112929830 (SMAD3)
   04068 FoxO signaling pathway
    112929830 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112929830 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    112929830 (SMAD3)
   04218 Cellular senescence
    112929830 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112929830 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    112929830 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112929830 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112929830 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112929830 (SMAD3)
   05212 Pancreatic cancer
    112929830 (SMAD3)
   05225 Hepatocellular carcinoma
    112929830 (SMAD3)
   05226 Gastric cancer
    112929830 (SMAD3)
   05220 Chronic myeloid leukemia
    112929830 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    112929830 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112929830 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112929830 (SMAD3)
   05161 Hepatitis B
    112929830 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 112929830
NCBI-ProteinID: XP_025867904
UniProt: A0A3Q7SVU3
LinkDB
Position
Unknown
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagaccgggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggctgcaggtgtcccatcgg
aaggggctcccgcatgtcatctactgccgcctgtggcgatggcccgacctgcacagccac
cacgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggacgaggtc
tgcgtgaatccctaccactatcagagggtagagaccccagttctacctcccgtgttggtg
ccacgccacacagagatcccggccgagttccccccgctggacgactacagccattccatc
cctgagaacactaacttccccgcgggcatcgagccccagagcaatattccagaaacccca
ccccctggctacctgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctctccccgaatccaatgtccccagcacacaataatttggac
ctgcagcctgtcacctactgcgagccggccttctggtgctccatctcctactacgagctg
aaccagcgcgtgggggagaccttccacgcctcgcagccctccatgacggtggacggcttc
accgacccctccaactcggagcgcttctgcctcggcctgctctccaacgtcaacaggaac
gcggccgtggagctcacgcggaggcacatcgggcgaggcgtgcggctgtactacatcggc
ggggaggtcttcgcggagtgcctcagcgacagtgccatctttgtccagtctcccaactgc
aaccagcgctacggctggcacccggccaccgtctgcaagatccccccagggtgcaacctg
aagatcttcaacaaccaggagtttgccgccctcctggctcaatctgtcaaccagggcttc
gaggcggtctaccagttgacgcggatgtgtaccatccgcatgagcttcgtcaaaggctgg
ggagcagaatacaggagacagacagtgaccagcaccccctgctggatcgagctgcacctg
aatgggcccttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system