KEGG   Vulpes vulpes (red fox): 112919203
Entry
112919203         CDS       T05911                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04064  NF-kappa B signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04115  p53 signaling pathway
vvp04140  Autophagy - animal
vvp04141  Protein processing in endoplasmic reticulum
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp04217  Necroptosis
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04340  Hedgehog signaling pathway
vvp04510  Focal adhesion
vvp04621  NOD-like receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04915  Estrogen signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05014  Amyotrophic lateral sclerosis
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05132  Salmonella infection
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05161  Hepatitis B
vvp05162  Measles
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05215  Prostate cancer
vvp05222  Small cell lung cancer
vvp05226  Gastric cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112919203 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    112919203 (BCL2)
   04630 JAK-STAT signaling pathway
    112919203 (BCL2)
   04064 NF-kappa B signaling pathway
    112919203 (BCL2)
   04066 HIF-1 signaling pathway
    112919203 (BCL2)
   04071 Sphingolipid signaling pathway
    112919203 (BCL2)
   04151 PI3K-Akt signaling pathway
    112919203 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112919203 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    112919203 (BCL2)
   04215 Apoptosis - multiple species
    112919203 (BCL2)
   04217 Necroptosis
    112919203 (BCL2)
   04115 p53 signaling pathway
    112919203 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112919203 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112919203 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112919203 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    112919203 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112919203 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    112919203 (BCL2)
   04722 Neurotrophin signaling pathway
    112919203 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112919203 (BCL2)
   05206 MicroRNAs in cancer
    112919203 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112919203 (BCL2)
   05226 Gastric cancer
    112919203 (BCL2)
   05215 Prostate cancer
    112919203 (BCL2)
   05222 Small cell lung cancer
    112919203 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    112919203 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    112919203 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112919203 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112919203 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112919203 (BCL2)
   05152 Tuberculosis
    112919203 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112919203 (BCL2)
   05161 Hepatitis B
    112919203 (BCL2)
   05162 Measles
    112919203 (BCL2)
   05168 Herpes simplex virus 1 infection
    112919203 (BCL2)
   05169 Epstein-Barr virus infection
    112919203 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112919203 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112919203 (BCL2)
   01524 Platinum drug resistance
    112919203 (BCL2)
   01522 Endocrine resistance
    112919203 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112919203 (BCL2)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112919203 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 112919203
NCBI-ProteinID: XP_025853342
UniProt: A0A3Q7SXF1
LinkDB
Position
Unknown
AA seq 173 aa
MAHAGRTGYDNREIVMKYIHYKLCRRGATTXRQAGDDFSRRYRRDFAEMSSQLHLTPFTA
RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLH
TWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggcgaacagggtacgataaccgggagatagtgatgaagtacatccac
tacaagctctgtcgcagaggggctactacgagncgccaggccggcgacgacttctcccgc
cgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcg
aggggacgctttgccacggtggtggaggagctcttcagggatggggtgaactgggggagg
atcgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatg
tcgcccctggtggacaacatcgccctgtggatgaccgagtacctgaaccggcatctgcac
acctggatccaggacaacggaggctgggatgcctttgtggaactgtacggccccaccatg
cagcctctgtttgacttctcctggctgtctctgaaggcgctgctcagtctggccctggtg
ggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system