KEGG   Vulpes vulpes (red fox): 112919269
Entry
112919269         CDS       T05911                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4 isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04310  Wnt signaling pathway
vvp04350  TGF-beta signaling pathway
vvp04371  Apelin signaling pathway
vvp04390  Hippo signaling pathway
vvp04520  Adherens junction
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04659  Th17 cell differentiation
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05161  Hepatitis B
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05220  Chronic myeloid leukemia
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112919269 (SMAD4)
   04350 TGF-beta signaling pathway
    112919269 (SMAD4)
   04390 Hippo signaling pathway
    112919269 (SMAD4)
   04371 Apelin signaling pathway
    112919269 (SMAD4)
   04068 FoxO signaling pathway
    112919269 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112919269 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112919269 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    112919269 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112919269 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112919269 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112919269 (SMAD4)
   05212 Pancreatic cancer
    112919269 (SMAD4)
   05225 Hepatocellular carcinoma
    112919269 (SMAD4)
   05226 Gastric cancer
    112919269 (SMAD4)
   05220 Chronic myeloid leukemia
    112919269 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112919269 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112919269 (SMAD4)
   05161 Hepatitis B
    112919269 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 112919269
NCBI-ProteinID: XP_025853390
UniProt: A0A3Q7TDP5
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTAQPATYHHNSTTTWTGSRSAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgttaccatacagagaacattggatggg
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgctcgtctctggagg
tggcctgatcttcataaaaatgaactcaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcctcaacggagacatacagtaccccagctctg
ttggctccatctgagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactgctcagccagctacttac
caccataacagcactaccacctggactggaagtaggagcgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccatcgcttactttgaaatggatgttcaagtaggagagacatttaag
gttccttcaagctgccctatcgttactgttgatggatatgtggacccttctggaggagat
cgcttttgcttgggtcaactctccaatgttcataggacagaagccattgagcgagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagtgaccatgcagtgtttgtgcagagttactacttagacagagaagctggtcgt
gcacctggagatgctgttcataagatctacccaagtgcatacataaaggtctttgacttg
cgtcagtgtcaccggcagatgcagcagcaggcggccaccgcacaggctgcagccgccgcc
caggcagcagccgtggcgggaaacatccctggccccggatcagtaggtggcatagctcca
gctatcagtttgtcagcggctgctggcattggtgtcgatgaccttcgccgcttgtgcata
ctcaggatgagtttcgtgaaaggctggggaccggattacccaagacagagcatcaaagaa
acgccttgctggatcgagattcacttacaccgggccctccagctcttagatgaagtgctt
cacaccatgcctattgccgacccacagcctttagactga

DBGET integrated database retrieval system