KEGG   Vulpes vulpes (red fox): 112919301
Entry
112919301         CDS       T05911                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112919301 (PMAIP1)
   04215 Apoptosis - multiple species
    112919301 (PMAIP1)
   04115 p53 signaling pathway
    112919301 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112919301 (PMAIP1)
   05203 Viral carcinogenesis
    112919301 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112919301 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112919301 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 112919301
NCBI-ProteinID: XP_025853478
UniProt: A0A3Q7SBM7
LinkDB
Position
Unknown
AA seq 54 aa
MPGRKARKGAQPGPTRAPGELEVECAIQLRKFGDKLNFRQKLLNLLSKLFRSGT
NT seq 165 nt   +upstreamnt  +downstreamnt
atgcccggcaggaaggcgcgcaagggcgcgcagcccggccccacgcgggcccccggagag
ctcgaagtggagtgtgccattcagctcaggaaatttggagacaaactgaatttccggcag
aaacttctgaatctgttatccaaactcttccgctcaggaacctga

DBGET integrated database retrieval system