KEGG   Vulpes vulpes (red fox): 112919473
Entry
112919473         CDS       T05911                                 

Gene name
PERP
Definition
(RefSeq) p53 apoptosis effector related to PMP-22
  KO
K10136  TP53 apoptosis effector
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112919473 (PERP)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 112919473
NCBI-ProteinID: XP_025853685
UniProt: A0A3Q7TEM3
LinkDB
Position
Unknown
AA seq 193 aa
MLRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHIQTSSLWWRCSQEGGGSGS
YEEGCESLMDYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAV
FQIISLVIYPVKYTQTFNLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDL
LGNAKPRYFYTSA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgctgcgctgcggcctggcctgcgagcgctgcaggtggatcctgcccctgctgctgctc
agcgccatcgccttcgacatcatcgcgctggccggccgcggctggctgcagtcgagcgac
cacatccagacgtcctcgctgtggtggcgatgctcccaggagggcggcggcagcgggtcc
tacgaggaaggctgcgagagcctcatggactatgcgtggggaagggcagcggccgccatg
ctcttctgtggctttatcatcctggtgatctgcttcatcctgtctttctttgccctctgc
ggaccccagatgctcgtcttcctgagagtgattggaggtctcctggccctggcagctgta
ttccagatcatctccctggtaatttatcctgtgaagtacacccagaccttcaatcttcat
gccaacccggctgtcacttacatctataactgggcctatggttttgggtgggcagccacg
attatcctgatcggctgtgccttcttcttctgttgtcttcccaactatgaagatgatctt
ctgggcaatgccaagcccaggtacttctacacatctgcctaa

DBGET integrated database retrieval system