KEGG   Vulpes vulpes (red fox): 112919752
Entry
112919752         CDS       T05911                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03460  Fanconi anemia pathway
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    112919752 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112919752 (POLK)
   05202 Transcriptional misregulation in cancer
    112919752 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112919752 (POLK)
   05212 Pancreatic cancer
    112919752 (POLK)
   05225 Hepatocellular carcinoma
    112919752 (POLK)
   05226 Gastric cancer
    112919752 (POLK)
   05214 Glioma
    112919752 (POLK)
   05216 Thyroid cancer
    112919752 (POLK)
   05220 Chronic myeloid leukemia
    112919752 (POLK)
   05217 Basal cell carcinoma
    112919752 (POLK)
   05218 Melanoma
    112919752 (POLK)
   05213 Endometrial cancer
    112919752 (POLK)
   05224 Breast cancer
    112919752 (POLK)
   05222 Small cell lung cancer
    112919752 (POLK)
   05223 Non-small cell lung cancer
    112919752 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112919752 (POLK)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     112919752 (POLK)
DNA repair and recombination proteins [BR:vvp03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    112919752 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 112919752
NCBI-ProteinID: XP_025854076
UniProt: A0A3Q7S563
LinkDB
Position
Unknown
AA seq 861 aa
MDSTKEKNGNYKDDLLLRMGLNDNKAGMEGLDKDKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRYAMELEQSRDLNNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYYARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSTE
VKEILADYDPNFLAMSLDEAYLNITKHLQERQNWPEDKRKYFIKTGNPLENDKPRKEVNK
LREHERSISPLLFDDSPPDMQSQGNPLQGNSDEEDNPQTLQNSIVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQVLPNRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHHFLHISLGLGSTHLARDGERKSMSVER
TFSEISKAEEQYNLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVVST
TEEIFAIAKELLRTEIDADFPHPLRLRLMGVRLSSFPNEEDKRHQQRSIIGFLQAGNQSQ
SAPRCILENTDKDQFLKSLEMSHKKSFFDKKRSERKWSHQDTFKCEAVDKQSLQTSHSFQ
VLKKKMNENLETSENSNNSQIFTCPICFREQRSISLEAFNKHVDACLDGPSISGTSNMFS
HSHASSTEVNKKENVYPSFSQSEKQDYETHQRNSEINFIELPETEDNPAKAESVDALSDK
HSKEECASLPSKPFNIEKCCQNSSSTVSLEDIASLSRQESSQPYLQALVCPVCNLEQKTS
DLTLFNVHVDVCLNKGIIQELRKDKVNLANQPRENTKSTDNSGRVQKTATKPKRPGLMTK
YSASKKTKPNNSRHTLDVFFK
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggatagcaccaaggagaagaatggcaattacaaagatgatcttctgcttaggatggga
cttaatgataataaagccggaatggaaggattagataaagacaagattaacaaaattata
atggaagccacgaaaggatccagattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaattaccagccaacagctaagg
aaagcacaattacaggttgacagatacgcaatggaattagaacagagccgggatctgaac
aatactatagtgcacattgacatggatgctttctatgcggctgtagaaatgagggacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgttgtctacctcaaat
tactatgcaagaaggtttggtgttcgtgcagccatgccaggatttattgctaaaagactc
tgcccacaacttattatagtgcccccaaactttgacaaatatcgagctgtgagtacagag
gttaaggaaatacttgctgattatgatcccaattttctggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttacaggaaagacaaaattggcctgaggacaaaaggaag
tatttcatcaaaacagggaaccctctagaaaatgataaaccaagaaaagaagttaataaa
ctgagggagcatgaacggtccatctctccactactttttgatgatagtcctcctgatatg
cagtcccaaggaaatcctttacaagggaactctgatgaagaggataatcctcaaacactc
caaaattctattgtttttggaacatcagctgaggaagtggtaaaggaaattcgtttcaga
attgagcaaaaaacaacactgactgccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaagttctccccaacagacaa
gctgtgatggacttcatcaaggacttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcacttggaattattacttgtacagaactctaccaacagagg
gcattactttctcttcttttctctgaaacatcttggcatcattttcttcatatttccctg
ggtctaggttcaacacacctggcaagggatggagaaaggaaaagcatgagcgttgagagg
acattcagtgagataagtaaagcagaagaacagtataacttgtgccaggaactttgcagt
gaacttgctcaagatctgcagaaagaaggactaaagggtagaactgttaccattaaactg
aagaatgtaaattttgaggtaaaaactcgtgcatctacagtttcatctgttgtttctact
acagaagaaatatttgctattgctaaagagttgctaagaacagaaattgatgctgatttt
ccacatcccttgagattaagacttatgggtgtacgattatctagttttcccaatgaagaa
gacaagagacaccaacaaaggagcatcattggcttcttacaggctggaaaccaatctcag
tcagcccctaggtgtatactagagaatactgacaaagatcagtttctaaaatctttagaa
atgtctcataagaagagtttctttgataaaaagcgatcagaaaggaaatggagccaccaa
gacacatttaaatgtgaagctgtggataagcaaagtttacagacatcacattcatttcaa
gttttaaagaagaagatgaacgagaatctcgaaacatcagagaattcaaataactctcag
atatttacttgtcccatttgctttagagagcaaagaagcatcagtctagaagcctttaat
aaacatgtagatgcatgtcttgatggaccttcaatcagtggaacctctaacatgttctca
cattcacatgcttcctctacagaagttaacaagaaagaaaatgtatatccttctttctca
cagagtgagaaacaggattatgaaacccatcagaggaattcagaaatcaattttatagag
ctaccagagactgaagataacccagctaaagcagaaagtgtagatgctttaagtgataag
cacagcaaagaggaatgtgctagtcttccaagtaaaccatttaatattgagaaatgttgt
cagaattcttcctctactgtttcattggaagatattgcgtcattaagtcggcaagaatcc
tcccagccttatttacaagctctagtttgtcctgtttgtaacctagaacaaaagacttca
gatcttaccctgttcaatgtgcatgtggatgtatgcttaaataagggcattatccaggaa
ctgagaaaggataaagttaacctagctaaccaacccagagaaaacaccaaaagtactgat
aactcaggcagagtgcagaagactgcaacaaaaccaaaaaggccgggattgatgacaaag
tactcagcatcaaagaaaacaaaaccaaacaattccagacacactcttgatgtatttttt
aaatga

DBGET integrated database retrieval system