KEGG   Vulpes vulpes (red fox): 112919933
Entry
112919933         CDS       T05911                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04015  Rap1 signaling pathway
vvp04115  p53 signaling pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04350  TGF-beta signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05144  Malaria
vvp05165  Human papillomavirus infection
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112919933 (THBS1)
   04350 TGF-beta signaling pathway
    112919933 (THBS1)
   04151 PI3K-Akt signaling pathway
    112919933 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112919933 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112919933 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    112919933 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112919933 (THBS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112919933 (THBS1)
   05205 Proteoglycans in cancer
    112919933 (THBS1)
  09162 Cancer: specific types
   05219 Bladder cancer
    112919933 (THBS1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112919933 (THBS1)
  09174 Infectious disease: parasitic
   05144 Malaria
    112919933 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112919933 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112919933 (THBS1)
   04990 Domain-containing proteins not elsewhere classified [BR:vvp04990]
    112919933 (THBS1)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112919933 (THBS1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112919933 (THBS1)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112919933 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 cEGF EGF_CA TSP1_ADAMTS TSP1_CCN Laminin_G_3 Laminin_G_2 EGF Laminin_G_1
Other DBs
NCBI-GeneID: 112919933
NCBI-ProteinID: XP_025854228
UniProt: A0A3Q7SDJ4
LinkDB
Position
Unknown
AA seq 1170 aa
MGLAWALGVLLLLHVCAASRLPESGGDNSVFDVFELTGAARRGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAIERKDHSGQVFSVV
SNGRAGTLDLSLTVQGMQHVVSVEEALLATGQWKSVTLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLASVARLRIAKGGVNDNFQGVLQNVRFVFGTTPEAILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELAIELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSLWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDATENQI
CNKQDCPIDGCLSNPCFAGVKCTSYRDGSWKCGTCPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGPQPFGRGVEHATAHKQVCKPRNPCTDGTHDCNKN
AKCSYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENIDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggggctggcctgggcgctcggcgtcctgctcctgctgcacgtgtgcgccgccagccgc
cttccagagtctgggggagacaacagcgtgttcgacgtctttgaactcaccggggctgcc
cggaggggctccgggcgccggctggtgaagggtcctgacccctccagccccgctttccgc
atcgaggacgccaacctgatcccccccgtgcctgacgacaagttccaagacctcgtggat
gctgtgcgggcagagaaaggcttcctcctcttggcctccctgcggcagatgaagaagacc
cgaggcacactgctggccatagaacggaaagaccactctggccaggtcttcagcgtggtc
tccaacggcagagccggcaccctggacctgagcctgaccgtgcagggcatgcagcacgtg
gtgtcggtggaagaggcgctgctggccaccgggcagtggaagagcgtcaccctgttcgtg
caggaggacagggcccagctgtacattgactgtgagaagatggagaacgccgagctggat
gtccccatccagagcatcttcaccagggacctggccagcgtggccagactccgcatcgcg
aaaggaggggtcaatgacaacttccagggggtgctgcagaacgtgaggtttgtctttgga
accacaccagaagccattctcagaaacaaaggctgttccagttcgaccaacgtcctcctc
accctcgataacaatgtggtaaatggctccagccctgccatccgcactaactacatcggc
cacaagactaaggatctgcaagccatctgcggcatctcttgtgatgagctatccagcatg
gttctggaattgaggggcctgcgcaccatcgtgaccacacttcaggacagcatccgcaaa
gtgactgaagagaacaaagaactggccattgagctgaggcggcctcccctctgctaccac
aatggagttcagtacaggaacaatgaggagtggaccgtcgatagttgtaccgagtgccgc
tgtcagaactccgttaccatctgcaagaaggtgtcctgccccatcatgccctgctccaac
gccaccgttcctgacggagaatgctgcccacggtgttggcccagcgactctgcggatgat
ggctggtccccatggtccgagtggacctcctgctctgcgacatgtggcaacggaatccag
cagcgcgggcgctcctgtgatagtctcaacaaccgatgcgagggctcctccgtccagacg
cggacttgccacattcaggagtgcgacaagagatttaaacaggatggcggctggagccac
tggtccccgtggtcgtcttgttccgtgacgtgtggtgatggtgtgatcactagaattcga
ctctgcaattctcctagcccccagatgaacgggaaaccatgtgaaggcgaagcccgggag
accaaggcctgcaagaaagacgcctgccccatcaatggaggctggggtccctggtcactg
tgggacatctgttccgtcacctgtggaggaggggtgcagaaacgtagccggctctgcaac
aaccccacaccccagtttggaggcaaggactgtgtcggtgatgcgaccgaaaaccagatt
tgcaacaagcaggactgtccaattgatggatgcctgtccaatccctgctttgctggggtc
aagtgtactagttaccgcgatggcagctggaaatgtggaacttgccccccgggctacagc
gggaatggcatccagtgcaaagacgtggatgagtgcaaagaagtccctgacgcctgcttc
aaccacaacggagagcacaggtgcgagaacacggaccccggctacaactgcctgccctgc
ccaccacgcttcacaggcccgcagcccttcggccgcggtgtagaacatgccaccgcccac
aaacaggtgtgtaagccccggaacccctgcacagatgggacacatgactgcaacaagaat
gccaagtgcagctacctgggccactacagcgaccctatgtatcgctgcgagtgtaagccc
ggctatgcgggcaacggcatcatctgtggggaggacacagacctggacggctggccgaat
gaggacctggtgtgcgtggccaatgccacctaccactgcaaaaaggataactgccccaac
cttcccaactctgggcaggaagactacgacaaggacgggattggcgatgcctgtgatgac
gacgatgacaatgataaaatcccagacgacagggacaactgtcctttccattacaaccca
gcccagtatgactatgacagagatgacgtcggagaccgctgtgacaactgcccctacaac
cacaacccagatcaggctgacacggacaacaacggggaaggagatgcctgcgctgcagac
atcgatggggacggtatcctcaatgaacgtgacaactgtcagtatgtctacaacgtggac
cagagggacactgatatggatggggttggagatcagtgtgacaactgccccctggaacat
aatccagatcagcttgactctgactcagaccgcattggagatacctgtgacaacaatcag
gatattgatgaagacggccaccaaaacaacctggacaactgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaagatggcaagggagatgcctgtgaccatgatgatgacaat
gatggcattcctgatgacagggacaactgcagacttgtgcccaatcctgaccagaaggat
tccgatggtgatggtcgaggggatgcttgcaaagacgattttgaccatgacaatgtgcca
gacattgatgacatctgtcctgaaaacattgatatcagtgagactgatttccgcagattc
cagatgattcctctagatcccaaagggacgtcccaaaatgaccctaactgggtggtacgt
catcagggtaaagaactcgtccagaccgtcaactgtgatcctggacttgctgtaggttat
gatgagttcaatgctgtggactttagtggcaccttcttcatcaacacagagagggatgat
gactatgctggatttgtgtttggctaccagtctagcagccgcttctatgtggtgatgtgg
aagcaagtcacacagtcctactgggacaccaaccccactcgggctcagggatactctggc
ctttccgtgaaagtcgtgaactctaccaccgggccaggcgagcacctgcggaatgccctg
tggcacacaggaaacacccctggccaggtgcgcactctgtggcatgaccctcgacacata
ggctggaaagatttcactgcctacagatggcgactcagccaccggcccaagacgggtttc
attcgcgtggtgatgtatgaagggaagaaaatcatggccgattcaggacccatctatgac
aaaacttatgctggtggtaggctagggttgttcgtcttctctcaagaaatggtgttcttc
tctgacctgaaatacgaatgcagagattcctaa

DBGET integrated database retrieval system