KEGG   Vulpes vulpes (red fox): 112920880
Entry
112920880         CDS       T05911                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory-associated protein of mTOR isoform X1
  KO
K07204  regulatory associated protein of mTOR
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04136  Autophagy - other
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04714  Thermogenesis
vvp04910  Insulin signaling pathway
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112920880 (RPTOR)
   04152 AMPK signaling pathway
    112920880 (RPTOR)
   04150 mTOR signaling pathway
    112920880 (RPTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112920880 (RPTOR)
   04136 Autophagy - other
    112920880 (RPTOR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112920880 (RPTOR)
  09149 Aging
   04211 Longevity regulating pathway
    112920880 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    112920880 (RPTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    112920880 (RPTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112920880 (RPTOR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112920880 (RPTOR)
Membrane trafficking [BR:vvp04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    112920880 (RPTOR)
SSDB
Motif
Pfam: Raptor_N HEAT HEAT_2 WD40 Cnd1 HEAT_EZ Hyccin WD40_2
Other DBs
NCBI-GeneID: 112920880
NCBI-ProteinID: XP_025855702
UniProt: A0A3Q7T650
LinkDB
Position
Unknown
AA seq 1335 aa
MEAEMLQAPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILTTSSLTQSAPASPTNKGIHIHQAGGSPPTSSASSSSLTNDVAKQPVSRD
LPAGRPGAPGPAGVQYTPHSQQFPRTRKMFDKGPDQTTDDADDAAGHRSFVSATTQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRQQARQLIQKGISKLDDQIFLN
RNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALD
IHPQANLIACGSMNQFTAIYSGNGELINHIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRAR
NT seq 4008 nt   +upstreamnt  +downstreamnt
atggaggccgagatgctgcaggcgcccctcctggggctcggggaggaggacgaggccgac
ctcaccgactggaacctgcccttggcctttatgaaaaagcggcactgtgagaagatcgaa
ggctccaagtccttagcccagagctggaggatgaaggatcggatgaagacggtcagtgtt
gccttagttttgtgcctgaatgtcggcgtggaccctccagatgtggtgaagaccaccccc
tgtgcacgtttggagtgctggatcgatcctctgtcgatggggcctcagaaagctctggaa
accatcggtgcgaatttgcagaagcagtacgagaactggcagccgagggcccggtacaag
cagagccttgatcccactgtggacgaagtaaagaagctttgtacgtccttacgccgaaat
gccaaggaggagcgggttctcttccactacaacggccacggggtgcccaggcccaccgtg
aatggggagatctgggtcttcaacaagaactacactcagtacatccctctgtctatatat
gacctgcagacgtggatgggcagcccatcgatcttcgtctacgactgctccaatgccggc
ttgatcgtcaagtccttcaaacagtttgccctgcagagggagcaggagcttgaggtcgct
gccattaacccaaaccacccactcgcgcagatgcccctgcctccgtccatgaagaactgc
attcagctggcggcctgtgaggccaacgagctcctgcccatgatccccgacctcccggcc
gacctgttcacgtcgtgcctcaccacccccatcaaaatcgccctgcgctggttctgcatg
cagaaatgcgttagtctggtgcctggggtcacactggatttgatagaaaagattcctggc
cggctgaacgaccgcaggacccctctgggagaactgaactggatcttcacagcaatcaca
gacaccatcgcgtggaatgtgctccctcgggatctcttccaaaagctcttcagacaggac
ctgttggtggctagtctgtttcgaaattttctcctggcggaaaggatcatgaggtcttac
aactgcacccccgtcagcagcccacgcctgccccccacttacatgcacgcgatgtggcaa
gcctgggacctggccgtcgacatttgcctgtctcagctgcccaccatcatcgaggaaggc
actgcatttcggcacagtccgttctttgccgagcagctgaccgcgttccaggtgtggctc
acgatgggcgtggagaacaggaacccacccgagcaacttcccattgtcctgcaggtgctg
ctgagccaggtgcacaggctgagagccctggatttgctgggacgattcttggacctgggc
ccctgggccgtgagcttggccttgtctgtgggcatcttcccctacgtgctgaaactgctc
cagagctcagccagagagctgcggccccttctggttttcatctgggccaagatcctcgcc
gtggacagttcgtgtcaagctgacctggtgaaggacaacggtcacaaatacttcctgtcc
gtcttggccgacccttacatgccagccgagcaccggaccatgacggccttcatcctcgct
gtgatcgtcaacagctacaacacggggcaggaggcctgcctccagggaaacctgatcgcc
atctgcctggagcagctcaacgacccgcacccgctcctgcgccagtgggtggccatctgt
ctgggccgcatctggcagaactttgactcggccaggtggtgtggcgtgagggacagcgcg
cacgagaagctctgcagcctcctctctgaccccatccctgaggtgcgctgcgcggcagtc
ttcgccctcggaacctttgtgggcaactccgcagagaggaccgaccactcgaccaccatc
gaccacaacgtggccatgatgctggcccagctgatcaacgacgggagccctgtggtccgc
aaggaactggtggtggctctgagtcatcttgtcgttcagtacgaaagcaatttctgcacc
gtggccttgcagttcatggaggaggagaagaactaccccttgccttctccagcggccaca
gagggtgggagcctgaccccagtgcgggacagcccgtgcacccccagactccgctccgtg
agttcctatggaaacattcgtgccgtcaccactgcccgaagcttgaacaagtctttacag
aatctgagcttgacggaagaatccggcagctccgtggcgttctcccccgggaacctcagc
accagcagcagcgccagcagcaccctgggcagccccgagaacgaggagtacatcctgtcc
ttcgagaccatcgacaagatgcgtcgcgtcagctcctactcggccctcaactccctcatc
ggagtctcctttaacagtgtttacacgcagatctggagagtcttactgcacctggctgcg
gatccctatccagacgtttccgacttggccatgaaggtgctcaacagcattgcttacaag
gccacagtgaacgcccggccccagcgcatcctcaccacgtcctcgctcacccagtcggcg
cccgccagccccaccaacaagggcatccacatccaccaggcggggggctccccgccaaca
tccagcgccagcagctccagcctgaccaacgacgtggccaagcagccagtcagccgagac
ctgcccgcgggccgtcctggtgcccctggccccgctggggtgcagtacacgccccactcc
cagcagttcccccgcacacggaagatgtttgacaagggcccagaccagaccaccgacgat
gcagatgatgccgctggacacagaagctttgtctcggccacgacacagaccggcttctgt
gactggagcgcccggtacttcgcccagcctgtcatgaagatcccagaagagcacgacctg
gagagtcagatccgcaaggaacgagagtggcgatttctccgcaacacgcgcgtccgacag
caggcgcgccagctcatccagaagggtatctcaaaactggacgaccagatatttctgaac
aggaaccccggcgtcccctccgtggtcaagttccacccctttacaccgtgtgtggccgtg
gctgataaggacagcatctgtttctgggactgggagaagggggagaagctggattacttc
cacaacgggaacccccggtacaccagggtcaccgccatggagtacctcaacggccaggac
tgctcgctgctgctcacggccacggatgatggcgccatccgggtctggaagaacttcgca
gatttggagaagaacccagagatggtgacggcttggcaggggctctcggacatgctgccg
acaaccagaggagccgggatggtggtggactgggagcaggagaccggcctcctcatgagc
tcgggggacgtgcggatcgtccggatctgggacacggaccgtgagatgaaggtgcaggac
atccccacaggcgccgacagctgcgtgaccagcctgtcctgtgactcccaccgctccctc
atcgtggccggcctcggcgatggctccatccgtgtctacgaccgaaggatggcgctcagt
gaatgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaaggcctacctccag
aagcaccccgagggccacatcatgagcgtgagtgtcaacggggacgtgcgtttcttcgac
cctcggatgccagagtctgtgaacgtccttcagatcgtgaaggggctcacggccctcgac
atccacccccaggcaaacctgatcgcctgcggctccatgaaccagttcacggccatctac
agcgggaacggggagctcatcaaccacatcaagtactacgacgggttcatgggccagcgc
gtcggggccatcagctgcctggccttccacccgcactggcctcacctggccgtgggcagc
aacgactactacatctccgtgtactccgtggagaagcgtgccagatag

DBGET integrated database retrieval system