KEGG   Vulpes vulpes (red fox): 112921310
Entry
112921310         CDS       T05911                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04062  Chemokine signaling pathway
vvp04068  FoxO signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04540  Gap junction
vvp04630  JAK-STAT signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04714  Thermogenesis
vvp04722  Neurotrophin signaling pathway
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04912  GnRH signaling pathway
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04926  Relaxin signaling pathway
vvp04935  Growth hormone synthesis, secretion and action
vvp05034  Alcoholism
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112921310 (SOS2)
   04012 ErbB signaling pathway
    112921310 (SOS2)
   04014 Ras signaling pathway
    112921310 (SOS2)
   04630 JAK-STAT signaling pathway
    112921310 (SOS2)
   04068 FoxO signaling pathway
    112921310 (SOS2)
   04072 Phospholipase D signaling pathway
    112921310 (SOS2)
   04151 PI3K-Akt signaling pathway
    112921310 (SOS2)
   04150 mTOR signaling pathway
    112921310 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921310 (SOS2)
   04540 Gap junction
    112921310 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112921310 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112921310 (SOS2)
   04660 T cell receptor signaling pathway
    112921310 (SOS2)
   04662 B cell receptor signaling pathway
    112921310 (SOS2)
   04664 Fc epsilon RI signaling pathway
    112921310 (SOS2)
   04062 Chemokine signaling pathway
    112921310 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112921310 (SOS2)
   04912 GnRH signaling pathway
    112921310 (SOS2)
   04915 Estrogen signaling pathway
    112921310 (SOS2)
   04917 Prolactin signaling pathway
    112921310 (SOS2)
   04926 Relaxin signaling pathway
    112921310 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    112921310 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112921310 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    112921310 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921310 (SOS2)
   05206 MicroRNAs in cancer
    112921310 (SOS2)
   05205 Proteoglycans in cancer
    112921310 (SOS2)
   05231 Choline metabolism in cancer
    112921310 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112921310 (SOS2)
   05225 Hepatocellular carcinoma
    112921310 (SOS2)
   05226 Gastric cancer
    112921310 (SOS2)
   05214 Glioma
    112921310 (SOS2)
   05221 Acute myeloid leukemia
    112921310 (SOS2)
   05220 Chronic myeloid leukemia
    112921310 (SOS2)
   05211 Renal cell carcinoma
    112921310 (SOS2)
   05215 Prostate cancer
    112921310 (SOS2)
   05213 Endometrial cancer
    112921310 (SOS2)
   05224 Breast cancer
    112921310 (SOS2)
   05223 Non-small cell lung cancer
    112921310 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    112921310 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112921310 (SOS2)
   05160 Hepatitis C
    112921310 (SOS2)
   05163 Human cytomegalovirus infection
    112921310 (SOS2)
   05165 Human papillomavirus infection
    112921310 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112921310 (SOS2)
   01522 Endocrine resistance
    112921310 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:vvp04990]
    112921310 (SOS2)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   112921310 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 112921310
NCBI-ProteinID: XP_025856310
UniProt: A0A3Q7TMG2
LinkDB
Position
Unknown
AA seq 1442 aa
MSYTHNGHGEHTARTFSLHPELPVPAILGLRVASNQARLGKVERGERVCQTQESWVVWEK
GPRQAPAQADPPLPAPEPPQPRNPATGRRLSPLRGAHAPCGASPATRDNECRAQGAGRAA
TAGAGARRLPPGAVRGCRRVQEQVHPNLSANEESLYYIEELIFQLLNKLCMAQPRTVQDV
EERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYHVSLYI
VAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDDIGLVCLCEDE
PSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRNLFKPSDIDRIFSNISDI
HELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDILSPKFNEHFS
KLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKACSEEQEDREC
LNQAITALMNLQGSMDRIYKQYSPRRRPGXPVCPFYNRQLRSKHLAIKKMNEIQKNIDGW
EGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPGYSNAEYRLKE
KFIMRKTQICDKEDTCECKHAFELISKDENSIIFAAKSAEEKNNWMAALISLHYRSTLDR
MLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIKGGTVVKLIER
LTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLAVEKGEQPISA
DLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVRGKAMKKWVES
IAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPIEIARQLTLLE
SDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAIL
SRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILDEAVELSQDHF
KKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQ
QYQNQPYCLRIEPEMRRFFENLNPMGNASEKEFTDYLFNKSLEIEPRNCKQPPRFPRKST
FSLKSPGIRPNTGRHGSTSGTLRGHPMPLEREPYKISFSRIAETDLESTVSAPTSPNTPS
TPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLSEEPLIPPPLP
PRKKFDHDASNSKGNTKSDDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPLHSPPPPPPRD
PLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDPDWFRDVSTCPNSPNTPPSTPSPRV
PRRCYLLSSSHNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPSYRLPLLENAET
PQ
NT seq 4329 nt   +upstreamnt  +downstreamnt
atgtcctatacacacaatggccatggagagcacacagcccgaacgttctctctccatcct
gaacttcccgtgcctgcgattctggggctcagagtggcatcgaatcaggcccgtctcggg
aaggtcgagagaggggagcgtgtgtgtcaaacgcaggagagttgggtggtctgggagaaa
ggcccccggcaggccccggcacaggccgaccccccgctgccggccccggagcccccgcaa
ccccgcaaccccgcaaccggccggcgcctcagcccgctccgcggcgcgcatgctccgtgc
ggggcttctccggcgacccgggataatgagtgccgggcccagggggcgggccgagcggcg
actgcgggagccggagcgcggcggctgcccccgggcgctgtgcgcggctgccgcagggtt
caggagcaagtacatcccaatctctcagctaatgaagagtctctctattatattgaagag
ctgatttttcagctgcttaataaattatgcatggctcaaccaaggactgttcaagatgtg
gaggaacgtgttcaaaagacctttcctcatccaattgataaatgggctattgctgatgca
caatctgccatagaaaaacgaaaacgaagaaatcctctcttactgcctgtggacaaaatc
catccttcattgaaggaagttttagggtacaaagtggactatcacgtatccctgtatatt
gtggctgtactagagtatatctcagctgatattttgaagttggctggtaattatgttttt
aatatccgacattatgaaatatctcagcaggacattaaagtatcaatgtgtgcagataag
gttttgatggacatgtttgatcaggatgacataggtttggtttgtctttgtgaagatgaa
cctagttcttcaggtgaattaaactactatgaccttgttagaactgaaattgcagaagaa
aggcagtatctacgcgaactaaatatgatcataaaagtgtttcgagaagcctttctttcg
gacagaaatctgtttaaaccttctgatattgacagaattttcagtaacatttcagatata
cacgaattgactgtgaaacttctaggtttgattgaagacacagtggaaatgactgatgaa
agcagtcctcatcccttagctggcagctgttttgaagatttggcagaggagcaagcattt
gatccttatgaaacattatcacaggacattctttctccaaaatttaatgaacatttcagt
aagctgatggccagacctgcagtggctctacactttcagtccattgctgatggttttaaa
gaggcagttcgttatgtccttccacgccttatgctagtgcctgtttatcattgttggcac
tattttgaattattaaagcaattgaaagcatgtagtgaagagcaggaagacagagaatgt
ttgaaccaagctattaccgctcttatgaatctccagggtagcatggaccgaatttataag
cagtattcacctagacgccgacctggggntcctgtttgccctttttataaccgtcaatta
agaagcaagcatctagctattaaaaaaatgaatgaaattcagaaaaacatagatgggtgg
gaaggcaaagatattggacagtgttgtaatgaattcattatggaaggtccattgacacga
attggtgctaaacatgaacgacatatttttctctttgatggcttaatgattagctgtaag
cccaatcatagccagtcacgccttccaggttacagtaatgcagaatacagattaaaagaa
aaatttatcatgaggaagacacagatatgtgataaagaagatacttgtgagtgcaaacac
gcttttgagttgatatccaaagatgaaaacagcataatatttgctgctaaatcggctgaa
gagaaaaataattggatggccgcacttatttctcttcactatcgtagtacactagatcga
atgctagattcagtgttattgaaagaagaaaatgagcaaccattgagattaccaagtcct
gaagtatatcgttttgtggtaaaagactctgaggaaaacattgtttttgaagacaacttg
caaagtagaagtggaattcccattattaaaggaggaactgtggtgaaattaattgaaaga
ttaacatatcatatgtatgcagatcccaattttgttcgtacttttcttactacataccgt
tcattttgtaaaccacaggaattgctaagcttactgattgaacgatttgaaatcccagag
ccggaacctactgaagcagataaattggctgtagagaaaggcgaacagccaatcagtgca
gaccttaaaaggtttcgcaaggaatatgtccaaccagtacaacttaggatcttaaatgta
tttcggcactgggttgaacaccacttttatgactttgaaagggatttggagttgcttgaa
agactagaatccttcatttcaagtgtaagaggaaaagctatgaagaaatgggtagagtca
attgctaagatcatcaagaggaagaaacaagctcaggcaaatggaataagccataatatt
acctttgaaagtccacctccaccaattgaatggcatatcagcagaccaggacagtttgaa
acatttgatctcatgacactgcatccaatagaaattgcacgtcagctgacacttttggaa
tctgatctctacaggaaagtccaaccttctgaacttgtagggagtgtatggaccaaagaa
gataaagaaataaattctccaaatttattaaaaatgattcgccataccacaaatctcacc
ctttggtttgaaaagtgcattgtggaagcagaaaattttgaagaacgggtggcaatacta
agcagaattatagaaattctgcaagtttttcaagatttgaataatttcaatggtgtattg
gagatagtcagtgcagtaaattcagtatcagtgtacagactagaccatacttttgaggca
ttgcaggaaagaaaaaggagaattttggatgaagctgtggaattaagtcaagatcacttt
aaaaaatacctagtaaaacttaagtcaatcaatccaccttgtgtgcctttttttggaata
tatttaacaaatattctgaaaactgaagaagggaataatgattttttaaaaaagaaaggg
aaagatttaatcaatttcagtaagaggaggaaagtagctgaaattactggagaaattcag
cagtatcagaatcaaccttactgtttacggatagaaccagaaatgaggagattctttgaa
aaccttaaccccatgggaaatgcttctgaaaaggagtttacagattatttgttcaacaag
tcactagaaattgagccccgaaactgcaaacagccacctcgatttcctaggaaatcaact
ttctctttaaaatctcctggaatacggccgaatacaggccgacatggctctacctcaggc
actttacgaggtcatccaatgccgttagaaagagaaccatataaaataagctttagtcgg
attgctgaaactgatcttgaatcaactgtgtcagcgccaacctctccaaatacaccatct
actccacccgtatctgcttcttcagaccttagtgtgtttttagacgtggatctcaacagt
tcctgtggtagcaatagcatctttgctccagtcctcttgccgcattcaaagtctttcttc
agttcatgtggtagtttacataaactaagtgaagagccactgattcctcctccacttcct
cctcgaaaaaagtttgatcatgatgcttcaaattccaagggaaatacgaaatctgatgat
gacccccctgctattccaccaagacaacctcctcctccaaaggtaaaacctagagttcct
gctcctactggtgcatttgatgggcctctgcatagtccacctccaccgccaccaagagat
cctcttcctgatacccctccgccagttccccttcgtcctccagaacactttataaactgt
ccatttaatcttcagccacctccactaggacatctgcacagagatccagactggttcaga
gacgttagtacctgcccaaattcgccaaatactcctcccagcacaccctctccaagagta
ccacgtcgatgctacctgctcagttctagtcacaacaaccttgctcatcctcaagctccc
cctgtgccaccaaggcagaactcaagcccgcacctaccaaaactgccaccaaagacttat
aaacgggagctttcgcaccccccgtcatacagactgcctttactagaaaatgcagaaact
cctcaatga

KEGG   Vulpes vulpes (red fox): 112935267
Entry
112935267         CDS       T05911                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04062  Chemokine signaling pathway
vvp04068  FoxO signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04540  Gap junction
vvp04630  JAK-STAT signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04714  Thermogenesis
vvp04722  Neurotrophin signaling pathway
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04912  GnRH signaling pathway
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04926  Relaxin signaling pathway
vvp04935  Growth hormone synthesis, secretion and action
vvp05034  Alcoholism
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112935267 (SOS1)
   04012 ErbB signaling pathway
    112935267 (SOS1)
   04014 Ras signaling pathway
    112935267 (SOS1)
   04630 JAK-STAT signaling pathway
    112935267 (SOS1)
   04068 FoxO signaling pathway
    112935267 (SOS1)
   04072 Phospholipase D signaling pathway
    112935267 (SOS1)
   04151 PI3K-Akt signaling pathway
    112935267 (SOS1)
   04150 mTOR signaling pathway
    112935267 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112935267 (SOS1)
   04540 Gap junction
    112935267 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112935267 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112935267 (SOS1)
   04660 T cell receptor signaling pathway
    112935267 (SOS1)
   04662 B cell receptor signaling pathway
    112935267 (SOS1)
   04664 Fc epsilon RI signaling pathway
    112935267 (SOS1)
   04062 Chemokine signaling pathway
    112935267 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112935267 (SOS1)
   04912 GnRH signaling pathway
    112935267 (SOS1)
   04915 Estrogen signaling pathway
    112935267 (SOS1)
   04917 Prolactin signaling pathway
    112935267 (SOS1)
   04926 Relaxin signaling pathway
    112935267 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    112935267 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112935267 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    112935267 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112935267 (SOS1)
   05206 MicroRNAs in cancer
    112935267 (SOS1)
   05205 Proteoglycans in cancer
    112935267 (SOS1)
   05231 Choline metabolism in cancer
    112935267 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112935267 (SOS1)
   05225 Hepatocellular carcinoma
    112935267 (SOS1)
   05226 Gastric cancer
    112935267 (SOS1)
   05214 Glioma
    112935267 (SOS1)
   05221 Acute myeloid leukemia
    112935267 (SOS1)
   05220 Chronic myeloid leukemia
    112935267 (SOS1)
   05211 Renal cell carcinoma
    112935267 (SOS1)
   05215 Prostate cancer
    112935267 (SOS1)
   05213 Endometrial cancer
    112935267 (SOS1)
   05224 Breast cancer
    112935267 (SOS1)
   05223 Non-small cell lung cancer
    112935267 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    112935267 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112935267 (SOS1)
   05160 Hepatitis C
    112935267 (SOS1)
   05163 Human cytomegalovirus infection
    112935267 (SOS1)
   05165 Human papillomavirus infection
    112935267 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112935267 (SOS1)
   01522 Endocrine resistance
    112935267 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:vvp04990]
    112935267 (SOS1)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   112935267 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 112935267
NCBI-ProteinID: XP_025874699
UniProt: A0A3Q7TBZ1
LinkDB
Position
Unknown
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVSLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEADLPSVTGPPVPPRQSTSQHIPKLPPKTYKREHTHPSVH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagttcttcagcgaggagaacgcacccaagtggcgg
gggctgctggtgccggcgctgaagaaggtccaggggcaagttcatccgactcttgagtct
agtgacgatgctcttcaatatgttgaagaattaattttgcagttactaaatatgctatgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaattgaccaccaagtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaagctggtggggaattatgtacggaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattaatggacatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagagcaaact
tattatgatttggtaaaagcatttatggcagaaattcgacagtacataagggaactaaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgtaaagttactg
ggccatatagaagatactgtggaaatgactgatgaagggagcccccatcccttagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattttacggcctggttttcatgatcgtttccttagtcagttatcaaagcctggagca
gcactctatttacagtcaataggcgaaggtttcaaagaagctgttcagtatgttttaccc
aggctacttctagcccctgtttaccactgtctacattactttgaacttttgaagcagtta
gaagaaaagagtgaagatcaagaggacaaggagtgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcaaaagaatattgatggttgggagggaaaagacattggacaatgt
tgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagtttttcatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ttgatatctttacagtaccggagtacactggaaaggatgcttgatgtgacgatgctacag
gaagagaaggaggagcagatgaggctccctagtgccgatgtttatagatttgcagagcct
gactctgaagagaatataatatttgaagaaaacatgcagcccaaggctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggctcacgtaccatatgtacgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcagcccttgagtgcagaactaaaaaggtttagaaaagaa
tacatacagcctgtacaactgcgagtattaaatgtatgtcggcattgggtagagcaccac
ttctatgattttgaaagagatgcagatcttttgcagcggatggaagaatttattggaaca
gtgagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gtcgagtggcatataagcaggcctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctgtatcgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
cttctaaaaatgatccggcacaccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagattctacaa
gtctttcaagagctgaacaacttcaatggtgttcttgaggttgtcagtgctatgaactca
tcacctgtttacagactagaccacacatttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaattaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttacctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaaggcatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttattgt
ttacgagtagaatcagatatcaaaaggttttttgaaaatttgaatccaatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccctagagatagaaccacgaaac
cctaagcctctgccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgagacatcctacacctctgcagcaggagcca
aggaaaattagttatagtagaatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagtaccacagat
gtttgcagcgtttttgattccgaccattcgagcccttttcactcaagcagcgataccgtc
tttatccaagtttcactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagggcactgatgaagtacctgtcccccctcctgttcctccacgaagaaggccggaa
tctgcccccgccgaatcttcgccgtctaagattatgtctaagcatttggacagcccccca
gcaattcctcctaggcagcccacatctaaagcctattcaccgcgatattcaatatcagac
cggacctctatatcagaccctcctgagagccctcccttattaccaccacgagaacctgtg
aggacacctgatgttttctccagctcaccactacatctccagcctccccctctgggcaaa
aaaagtgatcatggcaatgccttcttcccaaacagcccttccccttttacaccacctcct
cctcaaacaccttctccccatggcacgagaaggcatctgccatcaccaccattgacacaa
gaagcggaccttccttcagtcactgggccgcctgttcctccacgacaaagcacttcccaa
catatccctaaactccctccgaaaacttataaaagggagcacacacacccatctgtgcac
agagatggaccacccctgttggagaatgcccattcttcctga

DBGET integrated database retrieval system