KEGG   Vulpes vulpes (red fox): 112921625
Entry
112921625         CDS       T05911                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04015  Rap1 signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04510  Focal adhesion
vvp04520  Adherens junction
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04670  Leukocyte transendothelial migration
vvp04916  Melanogenesis
vvp04919  Thyroid hormone signaling pathway
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05100  Bacterial invasion of epithelial cells
vvp05132  Salmonella infection
vvp05160  Hepatitis C
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112921625 (CTNNB1)
   04310 Wnt signaling pathway
    112921625 (CTNNB1)
   04390 Hippo signaling pathway
    112921625 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921625 (CTNNB1)
   04520 Adherens junction
    112921625 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112921625 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    112921625 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112921625 (CTNNB1)
   04916 Melanogenesis
    112921625 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921625 (CTNNB1)
   05205 Proteoglycans in cancer
    112921625 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112921625 (CTNNB1)
   05225 Hepatocellular carcinoma
    112921625 (CTNNB1)
   05226 Gastric cancer
    112921625 (CTNNB1)
   05216 Thyroid cancer
    112921625 (CTNNB1)
   05217 Basal cell carcinoma
    112921625 (CTNNB1)
   05215 Prostate cancer
    112921625 (CTNNB1)
   05213 Endometrial cancer
    112921625 (CTNNB1)
   05224 Breast cancer
    112921625 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112921625 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    112921625 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112921625 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112921625 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112921625 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112921625 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    112921625 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112921625 (CTNNB1)
   05163 Human cytomegalovirus infection
    112921625 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112921625 (CTNNB1)
   05165 Human papillomavirus infection
    112921625 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 112921625
NCBI-ProteinID: XP_025856740
UniProt: A0A3Q7T804
LinkDB
Position
Unknown
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacagtcttacctggattctggaatccattctggtgccact
accacagctccttctctcagtggtaaaggcaatcccgaggaagaagatgtggataccacc
caagtcctgtatgagtgggaacagggcttttctcagtccttcactcaagaacaagtagct
gatattgatggtcagtatgcaatgactcgagctcagagggtgcgggctgctatgttccct
gagacattagatgaaggcatgcagatcccatctacacagttcgatgctgctcatcctact
aatgtccagcgtttggctgaaccgtcacagatgctgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaattgcta
aatgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaacagctcgctgtactgctgggaccttgcacaat
ctttctcatcatcgtgagggcttgctggccatctttaagtctgggggcattcctgccctg
gtgaagatgcttggttcaccagtggattctgtattattttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtacgtttagccggtggactgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagactgc
cttcagattttagcttacgggaatcaggaaagcaagctgatcattctggctagtggtgga
cctcaagctttagtaaatataatgaggacctacacttatgagaaacttctgtggaccaca
agcagagtattgaaggtgctgtctgtctgctctagtaataaaccagctattgtagaagca
ggtggaatgcaggctttagggcttcacctgacagatccaagtcaacgtcttgttcagaat
tgtctttggactctaaggaatctatcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggactcttgttcagcttctgggctcagatgatataaatgtggtcacgtgtgca
gctggaattctttctaatctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgtgctggtgacagggaggacatt
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagcagagatg
gcccagaatgctgttcgccttcactatggactgccagttgtggttaaactcctacaccca
ccatcccattggcctctaataaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctctgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgtgcccatcaggatacccagcgccgtacatctatgggtggaacacagcagcagttt
gtggagggggtccgtatggaagaaattgttgaaggttgtactggagcccttcatatccta
gctcgggatgttcacaaccgaatcgtaatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaagccattgaagcggagggagccacagctcctctg
acagagttacttcactctaggaacgaaggtgtagcaacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattacaagaaacggctttcggttgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggagcatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system