KEGG   Vulpes vulpes (red fox): 112921667
Entry
112921667         CDS       T05911                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp03430  Mismatch repair
vvp03460  Fanconi anemia pathway
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    112921667 (MLH1)
   03460 Fanconi anemia pathway
    112921667 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921667 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112921667 (MLH1)
   05226 Gastric cancer
    112921667 (MLH1)
   05213 Endometrial cancer
    112921667 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112921667 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vvp03400]
    112921667 (MLH1)
DNA repair and recombination proteins [BR:vvp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     112921667 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 112921667
NCBI-ProteinID: XP_025856816
UniProt: A0A3Q7SMQ4
LinkDB
Position
Unknown
AA seq 757 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
EAKCAYRATYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEVV
KSTTGVTPSSTGSGNKVYAHQMVRTDSREQKLDAFLQPMSKALSSQLQAVVPEDRTDVSS
GRTGQQDEEMFELPEPDQVAATNQGMEEEATEGTSETSEKKGPPSSPGNPRKRPRESSDV
EMVEDDSRKDMTAACTPRRRIINLTSVLSLQEEINERGHETLREMLHNHSFVGCVNPQWA
LAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFELAMLALDSPESGWTE
EDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILR
LATEVNWDEEKECFESLSKECAMFYSIRKQYVSEESTLSGQQSEVCGSSANPWKWTVEHI
VYKAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgtcgctcgtagcgggggttattcggcggttggacgagacagtggtgaaccgcatcgcg
gcaggggaagttatccagcggccggctaatgccatcaaggagatgattgagaactgttta
gatgcaaaatccaccagtatccaagtggttgttaaagagggaggcctcaagttgattcag
atccaagacaatggcactgggattaggaaagaagatctggatattgtgtgtgagaggttc
actacaagtaaactgcagtcctttgaggatttagctagtatttctacctatggctttcga
ggtgaggctttggctagcatcagccatgtggcacatgttactattacaaccaaaacagct
gaggcaaaatgtgcatacagagcaacttattcggatggaaagctgaaagctcctcctaaa
ccgtgtgcaggcaatcaggggacccaaatcacggtggaggaccttttttacaacatatcc
acgaggaggaaagctttaaaaaatccaagtgaagagtatgggaaaattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagttaaaaaacaaggcgagacc
gtagctgatgttaggacactgcccaatgccacaacggtggacaatattcgctccatcttt
ggaaatgctgtcagccgagaactgatagaagttgggtgtgaggataaaaccctagccttc
aaaatgaatggctacatatccaatgcaaattactcagtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagagtcaacttccttaagaaaagccattgaaacagtatat
gcagcatatttgcccaagaacacacaccctttcctgtacctcagtttagagatcagcccc
cagaacgtggacgtcaatgtacatcccacgaagcacgaagttcacttcctgcacgaggac
agcatcctggagcgggtgcagcagcacatcgagagcaagctcttgggatccaactcctcc
aggatgtacttcacccagactttactaccaggtcttgctggcccctctggagaggtggtt
aaatccacaacgggtgtgaccccctcatctactggaagtggcaacaaggtctatgcccac
cagatggtccgcacagattcacgagaacagaagctcgatgcctttctgcagcccatgagc
aaggctctgtccagtcagctgcaggctgttgtcccggaagacaggaccgatgtttccagt
ggcaggactgggcagcaagatgaggaaatgtttgaactcccagaacctgatcaagtggct
gccacaaatcagggcatggaggaggaggcaacagaggggacttcggaaacatcagagaag
aaagggcccccttccagcccaggcaaccccagaaagaggcctcgggaaagctctgatgta
gaaatggtggaagatgattcccgaaaggacatgaccgcagcatgtacccctcgacggagg
atcatcaacctcaccagtgttctgagcctccaggaagaaattaacgagcggggacatgag
acactccgagagatgctgcataaccactcctttgtgggctgcgtgaatcctcagtgggcc
ctggctcagcatcagaccaagttataccttctcaacaccaccaaattgagtgaagaactg
ttctatcagatactcatttatgattttgccaattttggtgttctgaggctctcggagcct
gcaccgctgtttgagctggccatgctcgccctggacagtcccgagagtggctggacggag
gaggatggtcccaaagaaggacttgccgaatacattgttgagtttctgaagaagaaggct
gagatgcttgcagactacttctctctggaaattgatgaggaagggaacctgattggatta
cccctgctgattgacaactatgtgccccctttggagggtctgcctatcttcattcttcga
ctagccacggaggtgaactgggatgaagagaaggaatgttttgaaagcctcagtaaagaa
tgtgctatgttttactccattcggaagcagtatgtatctgaggagtcgaccctctcgggc
cagcagagtgaagtatgcggctcctctgcaaacccctggaagtggactgtggaacacatt
gtctataaagccttccgctcacaccttctgcctcccaaacatttcacagaagatggaaat
atcctacagcttgctaacctgcccgatctgtacaaagtcttcgagaggtgttaa

DBGET integrated database retrieval system