KEGG   Vulpes vulpes (red fox): 112921727
Entry
112921727         CDS       T05911                                 

Gene name
COP1
Definition
(RefSeq) E3 ubiquitin-protein ligase COP1
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112921727 (COP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112921727 (COP1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112921727 (COP1)
Ubiquitin system [BR:vvp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112921727 (COP1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     112921727 (COP1)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf_C2H2_10 zf-RING_10 zf-RING_11 zf-RING_4 Prok-RING_4 DZR zf-Nse
Other DBs
NCBI-GeneID: 112921727
NCBI-ProteinID: XP_025856846
UniProt: A0A3Q7SMT0
LinkDB
Position
Unknown
AA seq 742 aa
MFAIYKAPVTDFILTDSSQPRGMNGLTAEPRLVEGQRRALLSRSEPRVFSVASTEASEGD
SEAPAMPSPRAPAARPPGVLVAAAVSGSGGGAVSAGQSRLSCAARPSAGVGGSSSGLGSG
SRKRPLLAPLCNGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNR
CPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQILQDLLGTD
QDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVL
EEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSNIIDSTEYSQPPGFSGSSQTKKQPWY
NSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLA
TLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQDAVDIHYPENEMTC
NSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLL
ASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTK
QPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLA
SNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALP
DGESNVLIAANSQGTIKVLELV
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgtttgcaatttacaaagcaccggtgactgacttcatcttaacggactcctcgcaaccg
cgtggaatgaatggtttgacagcagagcccagactcgttgagggtcaacgcagggctctt
ctcagccgctcagagccccgggtcttttccgtagcgtccacggaggcttcagaaggcgac
tcggaagcacctgccatgccctcgccgcgggcgcccgccgcccgcccgcccggcgtgctg
gtggcggccgccgtgtcgggcagcggcggcggggcggtgtccgcgggccagtctcggctc
agctgcgcggccaggcccagcgccggcgtgggagggagcagctccggcctcggcagcggc
agccggaagagacctctgctcgcccccctgtgcaacgggctcatcaactcctacgaggac
aaaagcaacgacttcgtgtgccctatctgctttgatatgattgaggaagcatacatgacg
aaatgtggccacagcttttgctacaagtgtattcatcagagtttggaggataataataga
tgtcccaagtgtaactatgttgtggataatattgaccatctgtatcctaatttcttggtg
aatgagcttattctcaaacagaagcaaagatttgaggaaaagaggttcaaattagaccac
tcagtgagtagcaccaatggccacaggtggcaaatattacaggatttgttgggaactgac
caagataaccttgatttggccaatgtcaacctcatgttggaattactagtgcagaagaag
aaacaactggaagcagaatcacatgcagcccaactacagatccttatggaattcctcaag
gttgcaagaagaaataagagagagcaactggaacagatccagaaggagctgagtgttttg
gaagaggatattaaaagagtggaagaaatgagtggcttgtattctcctgtcagtgaggat
agcacggtgcctcaatttgaagctccttctccatcacacagtaatattattgattccaca
gaatacagccaacctcctggtttcagtggcagttctcagacaaagaagcagccttggtat
aacagcacattagcatcacgaagaaaacgactcactgctcattttgaagacttagagcaa
tgttacttttctacaaggatgtctcgtatttcagatgatagtcgaactgcaagccagttg
gatgaatttcaggaatgcttgtccaagtttactcggtataattcagtacgacctttggct
acattgtcatatgctagtgatctctataatggttccagcatagtctctagtattgaattt
gaccgagattgtgactattttgcaattgctggggttacaaagaagattaaagtctatgaa
tatggcacagtcattcaggatgcggtggatattcattaccctgaaaatgaaatgacctgc
aattccaaaatcagctgtatcagttggagtagttaccataagaatctgttagccagcagt
gattatgaaggcactgtcatcctatgggatggattcacaggacagaggtcaaaggtctat
caggaacatgagaaaaggtgttggagtgttgactttaacttgatggatcctaaactcttg
gcatctggttctgatgatgcaaaagtgaagctatggtctacgaacctagacaactcagtg
gcaagcattgaggcgaaggctaatgtatgctgtgttaaattcagcccttcttctagatac
catttggcttttggctgtgcagatcactgtgtccactactatgatcttcgtaacactaaa
cagccaatcatggtattcaagggacaccgaaaagcagtctcttatgcaaagtttgtgagt
ggtgaggaaattgtctctgcctcaacagacagccagctaaagctgtggaatgtagggaaa
ccatactgtctacgttccttcaagggtcacatcaatgaaaaaaactttgtaggcctcgct
tccaatggcgattatatagcttgtggaagtgagaacaactctctttacttatactataaa
ggactttctaagactttgctaacttttaagtttgatacggtcaaaagtgttctggataaa
gaccgaaaagaagatgatacaaatgaatttgttagtgccgtgtgctggagggcattgcca
gatggggagtccaatgtgctgattgctgctaacagtcagggtacaattaaggtgctggag
ttggtatga

DBGET integrated database retrieval system