KEGG   Vulpes vulpes (red fox): 112921762
Entry
112921762         CDS       T05911                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04068  FoxO signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04217  Necroptosis
vvp04650  Natural killer cell mediated cytotoxicity
vvp04722  Neurotrophin signaling pathway
vvp04932  Non-alcoholic fatty liver disease
vvp04940  Type I diabetes mellitus
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05142  Chagas disease
vvp05143  African trypanosomiasis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05320  Autoimmune thyroid disease
vvp05330  Allograft rejection
vvp05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112921762 (FASLG)
   04014 Ras signaling pathway
    112921762 (FASLG)
   04068 FoxO signaling pathway
    112921762 (FASLG)
   04151 PI3K-Akt signaling pathway
    112921762 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112921762 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112921762 (FASLG)
   04217 Necroptosis
    112921762 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112921762 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112921762 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921762 (FASLG)
   05205 Proteoglycans in cancer
    112921762 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112921762 (FASLG)
   05330 Allograft rejection
    112921762 (FASLG)
   05332 Graft-versus-host disease
    112921762 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    112921762 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112921762 (FASLG)
   04932 Non-alcoholic fatty liver disease
    112921762 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112921762 (FASLG)
   05161 Hepatitis B
    112921762 (FASLG)
   05160 Hepatitis C
    112921762 (FASLG)
   05164 Influenza A
    112921762 (FASLG)
   05162 Measles
    112921762 (FASLG)
   05168 Herpes simplex virus 1 infection
    112921762 (FASLG)
   05163 Human cytomegalovirus infection
    112921762 (FASLG)
   05165 Human papillomavirus infection
    112921762 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112921762 (FASLG)
   05143 African trypanosomiasis
    112921762 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112921762 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112921762 (FASLG)
   04052 Cytokines and growth factors [BR:vvp04052]
    112921762 (FASLG)
   04090 CD molecules [BR:vvp04090]
    112921762 (FASLG)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112921762 (FASLG)
Cytokines and growth factors [BR:vvp04052]
 Cytokines
  Tumor necrosis fators
   112921762 (FASLG)
CD molecules [BR:vvp04090]
 Proteins
  112921762 (FASLG)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 112921762
NCBI-ProteinID: XP_025856859
UniProt: A0A3Q7SAH5
LinkDB
Position
Unknown
AA seq 288 aa
MQQPLNYPYPQIYWVDSSANSPWVSPGSVLPCPSSAPGRPGQRRPPPPPPTLPPPPPPPP
PPPPXXXXXXXLHCLPPLKMRRDHNTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAE
LRESTSERHVAPSLEKQIGQPNPPSEKRELRKVAHLTGKPNSRSIPLEWEDTYGIALVSG
VKYKKGGLVINDTGLYFVYSKVYFRGQSCNNKPLNHKVYMRNSKYPQDLMLMEGKIMNYC
TTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcagcagcccttgaattacccctacccccaaatctactgggtggacagcagtgccaac
tctccttgggtctctccagggtcagtcctcccatgtccatcctctgcgccagggaggccc
gggcaaaggaggccaccgccaccaccgccgacactaccaccaccaccaccaccaccacca
ccaccaccaccnnnnnnnnnnnnnnnnnnnnncctccactgcctgccacctctgaagatg
aggagggaccacaacacaggcctgtgtctccttgtgatgtttttcatggttctggtggcc
ctggtcggattggggctggggatgtttcagctcttccatctacagaaggagctggctgaa
ctccgagagtctaccagcgaaaggcatgtagcaccatctttggagaagcaaataggtcaa
cccaatccaccttctgaaaaaagggagctgaggaaagtggcccatttaacaggcaagccc
aactcaagatccatccctctggaatgggaagacacatatggaattgcccttgtctctggg
gtgaagtataagaagggtggccttgtgatcaatgatactgggttgtactttgtgtattcc
aaagtgtacttcaggggtcagtcctgcaacaacaagcccctgaaccacaaggtctatatg
aggaactctaaatatccccaggacctgatgctgatggaggggaagatcatgaactactgc
actacgggccagatgtgggctcgtagcagctacttgggggcagtattcaatctcaccagt
gctgaccatttgtatgtcaatgtatccgaactatctctggtcagttttgaagaatctaag
acattttttggcttatataagctctaa

DBGET integrated database retrieval system