KEGG   Vulpes vulpes (red fox): 112921797
Entry
112921797         CDS       T05911                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04020  Calcium signaling pathway
vvp04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112921797 (CACNA1E)
   04020 Calcium signaling pathway
    112921797 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112921797 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:vvp04040]
    112921797 (CACNA1E)
Ion channels [BR:vvp04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112921797 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 112921797
NCBI-ProteinID: XP_025856916
UniProt: A0A3Q7SMZ5
LinkDB
Position
Unknown
AA seq 2318 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFTNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLGLGL
EKCEEERIISRGGSLKGDGGDLSSALDNQRSPLSLGKREPPWLARPCHGNCDPTQQEAGG
GETVVTFEDRARHRQSQRRSRHRRVRTEGKELSSTSRSRSVSQERSLDEGVLTDGEKERE
PRGGHAGKEPTIQEEDRGQDLRRTNSLMVPRGSGLAGALDEANTPLVLPHHDLEVGKDTV
LTEQEPEGSSEQALLGDVQLDIGRVISQSEPDLSCVTANTDKATTDSTSVTVAIPDVGPL
MDSTVIHISNKTDGEASPLKEAEIKEEEEEMEKKQQKKEKRETGKAMVPHSSMFIFSTTN
PIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFE
MVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVL
RVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTD
SSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQH
SVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLE
KNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYY
SAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILT
DSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFI
YAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEP
DTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHH
LDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAED
MTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKA
SDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPY
LQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQSSN
HGIYLPSDTQEHTGSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKRSNSSWLEEFSME
RSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRC
NSEERGTQADWESPERQQSRSPSEARSQTPNRQGTGSLSESSIPSISDTSTPRRSRRQLP
PVPPKPRPLLSYSSLIRHSGSISPPADGSERGSPLTPQALGSTEAGLAEPSGPRHGHGHG
HGQQSQHCSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPXXX
XXXXPTGYRRRRRGGPGSGVMCGAVSDLLSDTEEDDKC
NT seq 6957 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaaccccggtgccggcctcggggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgactggccgccgtttgagtacatgattttggccaccatcatt
gccaactgcattgtcttggccctggaacagcatcttcctgaggatgacaagaccccgatg
tcccgcagactggagaagacagagccgtatttcattgggatcttttgctttgaagccggt
atcaaaattgtggccctggggttcatctttcataagggctcgtacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcggggactcacttc
aacacacacgtggacctgaggaccctccgggctgtgcgtgtcctgagacccctgaagctc
gtgtcagggattcctagcctgcagatcgtgttgaagtctatcatgaaggccatggtgcct
cttctgcaaattggtctcctgctcttctttgccatcttgatgtttgctatcattggctta
gagttctacagtgggaagttgcaccgagcatgtttcacgaacaattcaggtattctggaa
ggatttgacccccctcacccatgtggtgtgcagggctgcccagctggctacgaatgccgg
gactggattggccccaatgatgggatcactcagtttgataacatcctttttgctgtgctg
actgtcttccaatgcatcaccatggaaggatggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaactggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaacctagttctgggagtgctctccggggagtttgccaaagagagagagaga
gtggagaaccggagagctttcatgaaactgcggcgacagcagcagattgagcgggagctg
aacgggtaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaataaa
aatgctgggacgtcagccttagaagtgcttcgaagggcaaccatcaaaaggagccggaca
gaggccatgactcgagactccagtgatgaacactgtgtcgatatctcctctgtgggcaca
cctctcgcccgagccagcatcaaaagcgcaaaggtggatggggcctcctatttccggcac
aaagaaaggcttctgcgcatctctatccgccatatggtgaaatcccaggtgttttactgg
attgtgttgagccttgtggctctcaacactgcctgtgtggccatcgtccatcataaccag
ccccagtggctcacccatctcctctactatgcagaatttttgtttctgggactgttcctc
ttggagatgtccctgaagatgtatggcatgggacctcgactttattttcactcttcattc
aactgttttgattttggggtcacagtgggcagcatctttgaagtggtctgggcaatcttc
agacctggcacatcttttggaatcagtgtcttacgggctctccggcttctaagaatattt
aaaataaccaagtattgggcatctctgcgaaatttggtggtctccttgatgagttctatg
aagtctatcatcagtttgctcttcctcctcttcctcttcatcgttgtctttgctctccta
ggaatgcagctgtttggaggcaggtttaactttaatgatgggactccttcagcaaacttt
gacaccttccctgcagccatcatgactgtattccagatcctaacaggtgaggactggaat
gaggtgatgtacaatgggatccgttcccagggtggagttagctcaggcatgtggtcagct
atctatttcattgtgctcaccttgtttggaaactacacactgctgaatgtgttcttggcc
attgctgtggacaatctggccaatgcccaagagctgaccaaggatgaacaagaagaagag
gaggcttttaaccagaaacatgcattgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttctatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcaccacatgtcggtgtgggagcag
cgcaccagccagctgagaaggcacatgcagatgtccagccaggaggccctcaataaagag
gaggccccaccgatgaaccccctcaaccccctcaacccgctgagccccctcaacccgctc
aacgcccaccccagcctctaccggagacccaggcctattgagggtctgggcctgggcctg
gagaagtgtgaggaggagcgcatcatcagccgcggggggtccctcaagggggatggaggg
gacctgtcgagtgccctggacaaccagaggagccctttgtccctgggcaaacgggagcca
ccatggctggccaggccctgtcatgggaactgtgatccgacccagcaggaggctggggga
ggggagaccgtggtgaccttcgaggaccgggccaggcacaggcagagccagcggcgcagc
cggcaccgtcgtgtcaggacggaaggcaaggagctctcctccacctcccggagcaggtct
gtcagccaggagcggagtctggatgagggggtgctcaccgacggggagaaggagcgagag
cccaggggcggccatgcaggcaaagaacccaccatccaggaagaagacagaggccaagac
ttaaggaggacgaacagtctgatggtgcccagaggctctgggctggcaggagccctcgat
gaggccaacacacccctagtcctgccccaccacgatctggaagtggggaaggacacggtg
ctgacggagcaggagccggagggcagcagcgagcaggccctgctgggggatgtgcagttg
gacattggcagggtcatcagccagagtgagcctgacctctcctgcgtcacagccaacaca
gacaaggccaccaccgacagcaccagcgtcaccgtcgccatccctgatgtgggccccttg
atggactcaactgtgattcacattagcaacaaaactgatggagaagccagtcccttgaag
gaggctgagatcaaagaggaggaggaggaaatggagaagaagcagcagaagaaggagaag
cgtgagacgggcaaagccatggtgccccacagctctatgttcatcttcagcaccaccaac
ccgattcgcagggcctgccactacatcgtgaacctgcgctactttgagatgtgcattctc
ctggtgatcgccgccagcagcattgccctggcagctgaggaccccgtcctgaccaactcg
gagcgcaacaaagtcctgaggtattttgactatgttttcactggcgtgttcacctttgag
atggttataaagatgatagaccagggcttgatcctacaggatgggtcctacttccgagac
ctgtggaacatcctggactttgtggtggtggttggtgcattggtggcctttgctttggcg
aacgctttgggaacaaacaaggggcgagacatcaagaccatcaaatccctgagggtgctc
cgagttctgaggccactgaagaccatcaagcgcttgcccaaactcaaggctgtctttgac
tgtgtggtgacctccttgaagaatgtcttcaacatactcatcgtctataagctcttcatg
ttcatctttgctgtcattgcggttcagctcttcaagggaaaattcttttattgcacagac
agttccaaggacacagagaaggagtgcataggcaactatgtagatcatgaaaaaaacaag
atggaggtgaaaggccgggaatggaagcgccatgaattccactacgacaacattatctgg
gccctgctgaccctcttcaccgtctccacgggggaaggatggcctcaagtcttacagcat
tctgtcgatgtgacagaggaagaccgaggaccaagccgcagcaaccgcatggagatgtcc
atcttctatgtggtctactttgtggtcttccctttcttctttgtcaatatctttgtggct
ctgatcatcatcaccttccaggaacaaggggacaagatgatggaggaatgcagcctggag
aagaacgagagggcgtgcattgacttcgccatcagtgccaaacctctcacccgctacatg
ccacagaacaggcacaccttccagtaccgcgtctggcacttcgtggtgtctccgtccttt
gagtacaccatcatggccatgatcgccctgaacaccgtcgtgttgatgatgaagtactac
tctgctccctgtacctatgaactggccctgaagtacctgaatattgccttcaccatggtg
ttttccctggaatgtgtcctaaagatcatcgcttttggcttcttgaactactttcgagac
acctggaacatctttgacttcatcactgtgattggcagtatcacagaaatcatactgaca
gacagcaagctggtaaacaccagtggtttcaacatgagctttctgaagctcttccgcgcc
gcccgcctcatcaagcttctgcggcagggctacaccatccgtattttactctggaccttc
gtgcagtcctttaaggccctcccctacgtctgccttttgattgccatgcttttcttcatc
tatgccatcattgggatgcaggtatttggaaacataaaattagatgaggagagtcacatc
aaccggcacaacaacttccggagtttctttgggtccctcatgttactcttcaggagtgcc
acgggagaggcctggcaggagataatgctgtcgtgcctcggggagaaaggctgcgagccc
gacaccactgcgccgtcggggcagaacgagaatgagcgctgtggcaccgatctggcctat
gtttactttgtctccttcatcttcttctgctctttcttgatgctcaacttgtttgtggcc
gtcatcatggacaacttcgagtacctgactcgggactcctccatcttagggccccaccac
ttggatgagtttgtccgcgtctgggcagagtatgaccgagctgcatgtggccgcatccat
tatactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagaga
tgtccctccaaagtggcatataagaggttggtcctaatgaatatgccagtagctgaggac
atgacggtccacttcacctccacactgatggctctgatccggacagccctggacatcaaa
attgccaaaggtggtgcagacaggcagcagctagactcggagctgcaaaaggagaccctg
gccatatggcctcacctgtcccagaagatgctagacctgcttgtgcccatgcccaaagcc
tctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactataaacag
agtaaggtgaagaaacagaggcagcagctggaggaacagaaaaatgcacccatgttccag
cgaatggagccctcatctctgcctcaggagatcattgctaatgccaaagccctgccctat
ctccagcaggaccctgtttcaggcctgagtggccgtagtggatacccttcgatgagtcca
ctctccccccaggaaatattccaattggcttgtatggatccagccgatgatggacagttc
caggaacagcagtctctggagccagaggttagtgaattaaaaagcgtgcagtcctctaac
catggcatctaccttccttcggacacccaggagcatacgggatctgggagggcatcttct
atgccacgcctgactgtggatccccaggtggtgacagatactagctccatgagacgttca
ttttccactattcgggataagcgttcaaattcctcctggttggaggaattctccatggag
agaagcagtgaaaacacctacaagtcacgtcgtcggagttaccactcctccctaagactg
tcagctcatcgcctgaattctgactcaggccacaagtctgacacccaccgctcagggggc
agagagcggggacggtcgaaagagcgaaagcatcttctctctcctgatgtctcccgctgc
aactcagaggagcgagggacccaggccgactgggagtccccagagcgccaacagtccagg
tctcccagtgaggccaggtcacagacccccaacagacagggcacgggctccctgagcgag
agctccatcccctccatctctgacaccagcaccccaagacgaagtcgccggcagctccca
cctgtcccaccaaagcctcggcccctcctctcctacagctccctgattcgacactcaggg
agcatctccccgccggccgacggaagcgagaggggctccccgctgaccccgcaggcgctg
gggagcacggaggccggcctggcggagccctcgggcccccggcacgggcacgggcatggg
cacgggcagcagagccagcactgctccccgcagcgctacatctccgagccctacctggcc
ctgcacgaagactcccacgcgtcggactgtggcgaggaggagacgctcaccttcgaagcc
gccgtggccaccagcctgggccgctccaacaccatcggctccgccccgccnnnnnnnnnn
nnnnnnnnnngcccaacgggctaccggcggcggcggcgcggggggccggggtcgggcgtg
atgtgcggggcggtcagcgacctcctgagtgacacggaagaagacgacaagtgctag

DBGET integrated database retrieval system