KEGG   Vulpes vulpes (red fox): 112921830
Entry
112921830         CDS       T05911                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00590  Arachidonic acid metabolism
vvp01100  Metabolic pathways
vvp04064  NF-kappa B signaling pathway
vvp04370  VEGF signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04657  IL-17 signaling pathway
vvp04668  TNF signaling pathway
vvp04723  Retrograde endocannabinoid signaling
vvp04726  Serotonergic synapse
vvp04913  Ovarian steroidogenesis
vvp04921  Oxytocin signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05140  Leishmaniasis
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05204  Chemical carcinogenesis
vvp05206  MicroRNAs in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112921830 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112921830 (PTGS2)
   04064 NF-kappa B signaling pathway
    112921830 (PTGS2)
   04668 TNF signaling pathway
    112921830 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112921830 (PTGS2)
   04657 IL-17 signaling pathway
    112921830 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    112921830 (PTGS2)
   04913 Ovarian steroidogenesis
    112921830 (PTGS2)
   04921 Oxytocin signaling pathway
    112921830 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    112921830 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    112921830 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921830 (PTGS2)
   05206 MicroRNAs in cancer
    112921830 (PTGS2)
   05204 Chemical carcinogenesis
    112921830 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112921830 (PTGS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112921830 (PTGS2)
   05022 Pathways of neurodegeneration - multiple diseases
    112921830 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112921830 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112921830 (PTGS2)
   05165 Human papillomavirus infection
    112921830 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    112921830 (PTGS2)
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     112921830 (PTGS2)
SSDB
Motif
Pfam: An_peroxidase EGF
Other DBs
NCBI-GeneID: 112921830
NCBI-ProteinID: XP_025856993
UniProt: A0A3Q7SKL6
LinkDB
Position
Unknown
AA seq 604 aa
MLARALVLCAALAVVRAANPCCSHPCQNQGVCMSIGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLYLKPTPNTVHYILTHFKGVWNIVNNIPFLRNTIMKYVLTSRSHLIESPPTYNVNY
GYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKY
QVIDGEVYPPTVKDTQVEMIYPPHVPEHLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFIYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYTSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDGQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgctggcccgcgccctggtgctctgcgccgccctggcggtcgtccgcgcagcaaatcct
tgctgttcccacccatgtcaaaaccaaggtgtttgtatgagcataggatttgaccagtat
aagtgtgactgtacccggacaggattctacggcgaaaactgctcaacacctgaatttctg
acaagaataaaattatacctgaaacccactccaaatacagtacactacatacttacccac
ttcaagggagtctggaacattgtcaataacatccccttcctgcgaaatacaattatgaaa
tatgtgttgacatcccggtcacatttgattgagagtccaccaacttataatgtgaactac
ggctataaaagctgggaagccttttctaacctctcctattataccagagctcttccccct
gtgcctgatgactgtccaacacccatgggcgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaagtttcttctgcgaagaaagttcattcctgatccacaaggcacc
aatatgatgtttgcattctttgcccagcactttacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccaaaggattgggccatggggtggacttaaatcatgtttat
ggggaaactttggatagacagcataagctgcgccttttcaaggatggaaaaatgaaatat
caggtaattgatggagaggtttatcctcctaccgtcaaagatactcaggtcgagatgatc
tacccacctcatgttcctgaacacctgcagtttgctgtgggccaggaggtcttcggtctg
gtgcctggtctgatgatgtatgccaccatttggctgcgggagcataacagagtgtgtgat
gtgcttaaacaggagcacccagaatgggatgatgagcggttgttccagacgagcaggcta
atactgataggagaaaccattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaagctgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatcccctcctgcctgacacc
ttgcaaatagatgaccaggagtacaatttccaacagtttatctacaacaactctatatta
ttggaacatggccttacccagtttgtggaatcattcagcaggcaaattgctggcagggtt
gccggtggcaggaatgttccagctgcagtacaacaagtagcaaaagcttcgattgaccag
agcagacagatgaaataccagtctcttaatgagtatcgcaaacgctttaggctgaagccc
tatacatcattcgaagaactcacaggagagaaggaaatggctgcggggttggaggccctt
tatggtgatattgatgccatggagctgtatcctgccctcttggtagaaaagcctcgccca
gatgccatctttggtgagaccatggtagaaatgggagcaccattctccttgaaaggactt
atgggtaatcccatctgttcacctgactactggaagcctagcacctttggtggagaagta
ggctttaaaatcatcaacactgcctcaatccagtctctcatctgcaataacgtgaagggc
tgtccattcactgcattctctgttcaagacggacagctcaccaaaacagtcaccattaat
gcaagctcttcgcactccggtctagatgacatcaatcccacagtcctactgaaagaacgg
tcaactgaactatag

DBGET integrated database retrieval system