KEGG   Vulpes vulpes (red fox): 112922087
Entry
112922087         CDS       T05911                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04062  Chemokine signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04270  Vascular smooth muscle contraction
vvp04371  Apelin signaling pathway
vvp04540  Gap junction
vvp04611  Platelet activation
vvp04713  Circadian entrainment
vvp04720  Long-term potentiation
vvp04723  Retrograde endocannabinoid signaling
vvp04724  Glutamatergic synapse
vvp04725  Cholinergic synapse
vvp04726  Serotonergic synapse
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04911  Insulin secretion
vvp04912  GnRH signaling pathway
vvp04915  Estrogen signaling pathway
vvp04916  Melanogenesis
vvp04918  Thyroid hormone synthesis
vvp04921  Oxytocin signaling pathway
vvp04922  Glucagon signaling pathway
vvp04924  Renin secretion
vvp04925  Aldosterone synthesis and secretion
vvp04927  Cortisol synthesis and secretion
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04929  GnRH secretion
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp04961  Endocrine and other factor-regulated calcium reabsorption
vvp04970  Salivary secretion
vvp04971  Gastric acid secretion
vvp04972  Pancreatic secretion
vvp05010  Alzheimer disease
vvp05016  Huntington disease
vvp05017  Spinocerebellar ataxia
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05143  African trypanosomiasis
vvp05146  Amoebiasis
vvp05163  Human cytomegalovirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112922087
   04371 Apelin signaling pathway
    112922087
   04020 Calcium signaling pathway
    112922087
   04071 Sphingolipid signaling pathway
    112922087
   04022 cGMP-PKG signaling pathway
    112922087
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112922087
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112922087
   04062 Chemokine signaling pathway
    112922087
  09152 Endocrine system
   04911 Insulin secretion
    112922087
   04922 Glucagon signaling pathway
    112922087
   04929 GnRH secretion
    112922087
   04912 GnRH signaling pathway
    112922087
   04915 Estrogen signaling pathway
    112922087
   04921 Oxytocin signaling pathway
    112922087
   04935 Growth hormone synthesis, secretion and action
    112922087
   04918 Thyroid hormone synthesis
    112922087
   04928 Parathyroid hormone synthesis, secretion and action
    112922087
   04916 Melanogenesis
    112922087
   04924 Renin secretion
    112922087
   04925 Aldosterone synthesis and secretion
    112922087
   04927 Cortisol synthesis and secretion
    112922087
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112922087
   04270 Vascular smooth muscle contraction
    112922087
  09154 Digestive system
   04970 Salivary secretion
    112922087
   04971 Gastric acid secretion
    112922087
   04972 Pancreatic secretion
    112922087
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    112922087
  09156 Nervous system
   04724 Glutamatergic synapse
    112922087
   04725 Cholinergic synapse
    112922087
   04728 Dopaminergic synapse
    112922087
   04726 Serotonergic synapse
    112922087
   04720 Long-term potentiation
    112922087
   04730 Long-term depression
    112922087
   04723 Retrograde endocannabinoid signaling
    112922087
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112922087
  09159 Environmental adaptation
   04713 Circadian entrainment
    112922087
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922087
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112922087
   05016 Huntington disease
    112922087
   05017 Spinocerebellar ataxia
    112922087
   05022 Pathways of neurodegeneration - multiple diseases
    112922087
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112922087
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112922087
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112922087
   05163 Human cytomegalovirus infection
    112922087
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112922087
   05142 Chagas disease
    112922087
   05143 African trypanosomiasis
    112922087
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112922087
   04031 GTP-binding proteins [BR:vvp04031]
    112922087
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112922087
GTP-binding proteins [BR:vvp04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    112922087
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 112922087
NCBI-ProteinID: XP_025857297
UniProt: A0A3Q7SLC8
LinkDB
Position
Unknown
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacgggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcgggctactctgatgaagacaaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggctatgatcagagccatggacacgctcaagatcccc
tacaagtacgagcacaataaggctcatgcacaattagttcgagaagtcgatgtggagaag
gtgtctgcttttgagaatccatatgtagacgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgacagacgacgagagtatcagttgtccgactctaccaaatactat
cttaatgacttggaccgcgttgctgaccccgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccagaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcggacaatgagaaccgaatggaggaaagcaaagcactctttagaacgattatcaca
tatccctggttccagaactcttcggttattctattcttaaacaagaaagatcttctagag
gagaaaattatgtattcccacctagttgactacttcccagaatatgatggaccccagaga
gatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacatgcgccacagacaccgagaacatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggaatacaatctggtctaa

DBGET integrated database retrieval system