KEGG   Vulpes vulpes (red fox): 112922285
Entry
112922285         CDS       T05911                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04120  Ubiquitin mediated proteolysis
vvp04144  Endocytosis
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04625  C-type lectin receptor signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112922285 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112922285 (MDM2)
   04151 PI3K-Akt signaling pathway
    112922285 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112922285 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    112922285 (MDM2)
   04115 p53 signaling pathway
    112922285 (MDM2)
   04218 Cellular senescence
    112922285 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112922285 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112922285 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922285 (MDM2)
   05202 Transcriptional misregulation in cancer
    112922285 (MDM2)
   05206 MicroRNAs in cancer
    112922285 (MDM2)
   05205 Proteoglycans in cancer
    112922285 (MDM2)
   05203 Viral carcinogenesis
    112922285 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    112922285 (MDM2)
   05220 Chronic myeloid leukemia
    112922285 (MDM2)
   05218 Melanoma
    112922285 (MDM2)
   05219 Bladder cancer
    112922285 (MDM2)
   05215 Prostate cancer
    112922285 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112922285 (MDM2)
   05169 Epstein-Barr virus infection
    112922285 (MDM2)
   05165 Human papillomavirus infection
    112922285 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112922285 (MDM2)
   01522 Endocrine resistance
    112922285 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112922285 (MDM2)
   04121 Ubiquitin system [BR:vvp04121]
    112922285 (MDM2)
Enzymes [BR:vvp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112922285 (MDM2)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    112922285 (MDM2)
Ubiquitin system [BR:vvp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    112922285 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP CRT10 zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 112922285
NCBI-ProteinID: XP_025857531
UniProt: A0A3Q7SPK8
LinkDB
Position
Unknown
AA seq 432 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQHEEHADDL
PGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDW
LDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEXYRVTVYQAGESDTDSFEGDP
EISLADYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKIPEKATPENSTQVEEGFDV
PDCKKTAASDSRESCAEEIDDKITQASHSQESEDYSQPSTSNSIIYSSQEDVKEFEREET
QDKEEIVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCR
QPIQMIVLTYFP
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggagcaggagaccctggttagaccaaagccattgcttttgaagttgttgaagtct
gtaggtgcacaaaaagacacttatactatgaaagaggtgatattctatcttggccagtat
attatgactaaacgattgtatgatgagaagcaacagcatattgtgtattgttccaatgat
cttctaggagatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcatgaagaacatgcagatgattta
cctggtgaacggcagagaaagcgccacaaatctgatagtatttccctttcctttgatgaa
agccttgctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgagtca
acagggacgccatcaaatccggatcttgatgctggtgtaagtgaacattcaggtgattgg
ttggatcaggattcagtttcagatcaattcagtgtagaatttgaagttgagtctcttgat
tcagaagattatagccttagtgaagaaggacaagaactctcagatgaagatgatgagntg
tatcgagtaactgtgtatcaggcaggggagagtgatacagattcatttgaaggagatcct
gaaatttccttagctgactattggaagtgtacctcatgcaatgaaatgaatcctcctctt
ccacctcattgcaatagatgttgggcccttcgtgagaattggcttcctgaagataaaggg
aaaatccctgagaaagccacaccagaaaactcaacacaagtagaagagggctttgatgtc
cctgattgtaaaaaaactgcagccagtgattccagagaatcatgtgctgaggaaattgat
gataaaatcacacaagcctcccactcccaagaaagtgaggactattctcagccatcaact
tctaacagcatcatttatagcagccaagaagatgtcaaggaatttgagagagaagaaaca
caagacaaagaagaaattgtggaatctagttttccccttaatgccattgaaccttgtgtg
atttgccaaggtcgacctaaaaacggttgcattgttcatggcaaaacaggacatcttatg
gcatgcttcacgtgtgcaaagaagctaaagaaaaggaataagccctgtccagtatgtaga
caaccaattcaaatgattgtgctaacttatttcccctaa

DBGET integrated database retrieval system