KEGG   Vulpes vulpes (red fox): 112922331
Entry
112922331         CDS       T05911                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04530  Tight junction
vvp04660  T cell receptor signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04934  Cushing syndrome
vvp05160  Hepatitis C
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05212  Pancreatic cancer
vvp05214  Glioma
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112922331 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112922331 (CDK4)
   04115 p53 signaling pathway
    112922331 (CDK4)
   04218 Cellular senescence
    112922331 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112922331 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112922331 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922331 (CDK4)
   05203 Viral carcinogenesis
    112922331 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112922331 (CDK4)
   05225 Hepatocellular carcinoma
    112922331 (CDK4)
   05214 Glioma
    112922331 (CDK4)
   05220 Chronic myeloid leukemia
    112922331 (CDK4)
   05218 Melanoma
    112922331 (CDK4)
   05219 Bladder cancer
    112922331 (CDK4)
   05224 Breast cancer
    112922331 (CDK4)
   05222 Small cell lung cancer
    112922331 (CDK4)
   05223 Non-small cell lung cancer
    112922331 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112922331 (CDK4)
   04934 Cushing syndrome
    112922331 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112922331 (CDK4)
   05160 Hepatitis C
    112922331 (CDK4)
   05164 Influenza A
    112922331 (CDK4)
   05162 Measles
    112922331 (CDK4)
   05163 Human cytomegalovirus infection
    112922331 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112922331 (CDK4)
   05169 Epstein-Barr virus infection
    112922331 (CDK4)
   05165 Human papillomavirus infection
    112922331 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112922331 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112922331 (CDK4)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112922331 (CDK4)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112922331 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 112922331
NCBI-ProteinID: XP_025857605
UniProt: A0A3Q7TQY7
LinkDB
Position
Unknown
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQTVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctactcctcggtacgagccagtggctgagattggggttggtgcctatggaacggtg
tacaaggcccgtgatccgcacagcggccacttcgtggccctcaagagcgttagagtccct
aatggaggaggtgccggagggggccttcccatcagcacagttcgtgaagtggcattgctg
aggcggctggaggcttttgagcatcccaacgttgtccggctgatggacgtctgcgccact
gcccgaaccgaccgggagaccaaagtgaccctggtgtttgagcacgtggaccaagacctg
agaacgtacctggacaaggcacccccaccgggcttgccagtggagaccatcaaggacctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaagcccgagaacattctggtgaccagtggtgggacagtcaagctggctgattttggt
ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtat
cgtgctccagaagttcttctgcagtctacgtatgcaacacccgtggacatgtggagtgtc
ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccctagagggccccgtccagtacagacagtg
gtacctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aatccagagtga

KEGG   Vulpes vulpes (red fox): 112923889
Entry
112923889         CDS       T05911                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04934  Cushing syndrome
vvp05160  Hepatitis C
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05206  MicroRNAs in cancer
vvp05212  Pancreatic cancer
vvp05214  Glioma
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112923889 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112923889 (CDK6)
   04115 p53 signaling pathway
    112923889 (CDK6)
   04218 Cellular senescence
    112923889 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112923889 (CDK6)
   05206 MicroRNAs in cancer
    112923889 (CDK6)
   05203 Viral carcinogenesis
    112923889 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112923889 (CDK6)
   05225 Hepatocellular carcinoma
    112923889 (CDK6)
   05214 Glioma
    112923889 (CDK6)
   05220 Chronic myeloid leukemia
    112923889 (CDK6)
   05218 Melanoma
    112923889 (CDK6)
   05224 Breast cancer
    112923889 (CDK6)
   05222 Small cell lung cancer
    112923889 (CDK6)
   05223 Non-small cell lung cancer
    112923889 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112923889 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112923889 (CDK6)
   05164 Influenza A
    112923889 (CDK6)
   05162 Measles
    112923889 (CDK6)
   05163 Human cytomegalovirus infection
    112923889 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112923889 (CDK6)
   05169 Epstein-Barr virus infection
    112923889 (CDK6)
   05165 Human papillomavirus infection
    112923889 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112923889 (CDK6)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112923889 (CDK6)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112923889 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 112923889
NCBI-ProteinID: XP_025859548
UniProt: A0A3Q7SS30
LinkDB
Position
Unknown
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERCKENLDSHLPPSQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgcgcggaccagcagtacgagtgcgtggcggagatcggg
gagggggcctacgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgggtgcagacgggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcagattgttt
gatgtatgcacagtgtcacgaacagacagagaaacgaaactaacattagtgtttgaacat
gttgatcaagacttgaccacttatttggataaagtcccagagccgggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggcctggactttcttcattctcaccga
gtagtgcatcgcgatttaaaaccacagaacattttagtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggctcttacttcagtggtc
gtcacactgtggtacagagctccagaagtcctgcttcagtccagctatgccacccccgtg
gacctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagacgtcgatcaacttggaaaaatcttggacgtaattggactcccaggagaa
gaggactggcctagagatgtcgccctacccaggcaggctttccactcaaaatctcctcaa
ccgattgagaagtttgtgacggacattgatgaacaaggcaaagacctccttctgaagtgc
ttaacatttaatccagccaaaagaatatctgcctacagtgccctgtctcacccatacttc
catgacctggagaggtgcaaggaaaacttggattcccatctgccgcccagccagaacagc
tcagagatgaacacagcctga

DBGET integrated database retrieval system