KEGG   Vulpes vulpes (red fox): 112922404
Entry
112922404         CDS       T05911                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04114  Oocyte meiosis
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04914  Progesterone-mediated oocyte maturation
vvp04934  Cushing syndrome
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05215  Prostate cancer
vvp05222  Small cell lung cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112922404 (CDK2)
   04151 PI3K-Akt signaling pathway
    112922404 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112922404 (CDK2)
   04114 Oocyte meiosis
    112922404 (CDK2)
   04115 p53 signaling pathway
    112922404 (CDK2)
   04218 Cellular senescence
    112922404 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112922404 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922404 (CDK2)
   05203 Viral carcinogenesis
    112922404 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    112922404 (CDK2)
   05215 Prostate cancer
    112922404 (CDK2)
   05222 Small cell lung cancer
    112922404 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112922404 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112922404 (CDK2)
   05161 Hepatitis B
    112922404 (CDK2)
   05160 Hepatitis C
    112922404 (CDK2)
   05162 Measles
    112922404 (CDK2)
   05169 Epstein-Barr virus infection
    112922404 (CDK2)
   05165 Human papillomavirus infection
    112922404 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112922404 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vvp03032]
    112922404 (CDK2)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112922404 (CDK2)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112922404 (CDK2)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112922404 (CDK2)
DNA replication proteins [BR:vvp03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112922404 (CDK2)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112922404 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 112922404
NCBI-ProteinID: XP_025857775
UniProt: A0A3Q7TRE0
LinkDB
Position
Unknown
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHARCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
TPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaagtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgctatacgagagatctccctgcttaaggagcttaaccac
ccaaacattgtcaagctattggatgtcatccacaccgaaaacaaactctacctggttttt
gagtttctgcaccaggatctgaagaaatttatggatgcttctgctttgactggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagccttctgccattct
catcgggttctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc
atcaagctagcagactttggactagccagagcctttggagtccctgttcgtacttacacc
catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactac
tccacagccgtagatatctggagcttgggctgcatctttgctgagatgcacctagtgtgt
acccagcaccatgctaggtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
accccacaccccgtgacccgacgggccttattccctggagattctgaaattgaccaactt
ttccggatctttcggactctggggaccccagatgaagtggtttggccaggagttacttct
atgcctgattataagccgagtttccccaagtgggcccggcaagattttagcaaagttgtt
cctcccttggatgaagatggacggagcttgctttcgcaaatgctgcactacgaccccaac
aagcggatttcggcaaaggcagctctggctcaccctttcttccaggatgtgaccaagcca
gtaccccaccttcgactctga

DBGET integrated database retrieval system