KEGG   Vulpes vulpes (red fox): 112922873
Entry
112922873         CDS       T05911                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp04217  Necroptosis
vvp04620  Toll-like receptor signaling pathway
vvp04621  NOD-like receptor signaling pathway
vvp04622  RIG-I-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04657  IL-17 signaling pathway
vvp04668  TNF signaling pathway
vvp04932  Non-alcoholic fatty liver disease
vvp05010  Alzheimer disease
vvp05016  Huntington disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05132  Salmonella infection
vvp05134  Legionellosis
vvp05142  Chagas disease
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112922873 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112922873 (CASP8)
   04215 Apoptosis - multiple species
    112922873 (CASP8)
   04217 Necroptosis
    112922873 (CASP8)
   04115 p53 signaling pathway
    112922873 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112922873 (CASP8)
   04621 NOD-like receptor signaling pathway
    112922873 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    112922873 (CASP8)
   04625 C-type lectin receptor signaling pathway
    112922873 (CASP8)
   04657 IL-17 signaling pathway
    112922873 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922873 (CASP8)
   05203 Viral carcinogenesis
    112922873 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112922873 (CASP8)
   05016 Huntington disease
    112922873 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    112922873 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112922873 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112922873 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112922873 (CASP8)
   05134 Legionellosis
    112922873 (CASP8)
   05152 Tuberculosis
    112922873 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112922873 (CASP8)
   05161 Hepatitis B
    112922873 (CASP8)
   05160 Hepatitis C
    112922873 (CASP8)
   05164 Influenza A
    112922873 (CASP8)
   05162 Measles
    112922873 (CASP8)
   05168 Herpes simplex virus 1 infection
    112922873 (CASP8)
   05163 Human cytomegalovirus infection
    112922873 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112922873 (CASP8)
   05169 Epstein-Barr virus infection
    112922873 (CASP8)
   05165 Human papillomavirus infection
    112922873 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112922873 (CASP8)
   05142 Chagas disease
    112922873 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112922873 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vvp01002]
    112922873 (CASP8)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     112922873 (CASP8)
Peptidases and inhibitors [BR:vvp01002]
 Cysteine peptidases
  Family C14: caspase family
   112922873 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 112922873
NCBI-ProteinID: XP_025858328
UniProt: A0A3Q7SNY4
LinkDB
Position
Unknown
AA seq 486 aa
MDFSKCLYNIGEQLDSDELASLKFLSLDYIPQKKQEPIKDPLMLFQRLQEKRMLEESNLF
FLKELLFRINRLDLLMTYLDTSKEDMQQELQIPGRAQISAYRVMLFQISEDVSKLELKSF
KFLLSREISRCKLDDDLNLLDIFIEMEKRVILGERNLDTLKRICDQINKSLLKKITDYEE
LNREQTMNLQRSLDEISNDMSQLPIREGSVKILPMSDSLGEQDYESETSDKVYRMKSKPR
GYCLIFNNYDFSVARREVPKLQSIKDRNGTDLDADALSKTFSELHFEIVHFKDATAKKIC
EVLQSYQSMDHSSKDCFICCILSHGDKGIIYGSDGQEAPIYELTSYFTGSKCPSLAGKPK
IFFIQACQGDKYQKGIAVETDSEQKEAYLEMDSSYQKRYIPEDADFLLGMATVNNCVSYR
NPMEGTWYIQSLCQSLRERCPRGEDILTILTEVNFEVSNKDDRKNMGKQMPQPTFTLRKK
LFFPPN
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggatttcagcaaatgtctctacaatattggggaacagctggacagtgacgaactggcc
tccctcaaattcctgagcttggactacatcccacagaagaagcaggagcccatcaaggat
cccttgatgttattccagagactccaggaaaagagaatgttggaggaaagcaacctgttc
tttttgaaggagctgcttttccgaattaatagactggatctgctgatgacctacctggac
accagcaaggaagacatgcagcaggagcttcagataccaggcagagcccagatctctgcc
tacagggtcatgctttttcagatttcagaagatgtaagcaaattggaattgaaatccttt
aagtttctcttgagccgggagatctccagatgtaaattggatgatgatttgaacttgctt
gatattttcatagagatggagaagagggtcattctaggggaaagaaatttggacaccctg
aaaagaatctgtgaccaaatcaacaaaagcctgctgaagaaaatcacagattatgaagaa
ttaaacagagagcaaacaatgaaccttcaaagaagtctagatgaaatttcaaatgatatg
tctcagttgcctataagggagggatccgtgaagatattgccaatgtcggactctctagga
gaacaggactatgaatcagagacatcagacaaagtttaccgaatgaaaagcaaacctcga
ggatattgtttgatcttcaacaattatgattttagtgtagcacggagggaagtgcccaaa
cttcagagcattaaggataggaatggaacagacttggatgcagatgcgttgagtaagacc
tttagtgagcttcattttgagatagtgcatttcaaagatgctacagcaaagaaaatctgt
gaagttctgcaatcctaccaaagcatggaccacagtagcaaggattgcttcatctgctgc
atcctctcccatggagacaagggcattatctatggctctgatgggcaggaagcccctatc
tatgagctgacctcttacttcactggttcaaagtgcccttcccttgcaggcaagcccaaa
atcttttttattcaggcttgtcaaggggataaataccagaaaggaatagctgttgagact
gactctgaacagaaggaagcctatttagaaatggactcatcatatcagaagagatatatc
ccagaggatgctgactttctgctggggatggccactgtgaacaactgtgtttcctaccga
aatcccatggaggggacatggtatatacaatcactttgccagagcctaagagaaagatgt
cctaggggtgaagatattctcaccatccttaccgaggtgaactttgaagtgagcaataaa
gatgacaggaaaaacatgggaaaacaaatgccacaaccaactttcacactgagaaaaaaa
ctcttcttccctcctaattga

DBGET integrated database retrieval system