KEGG   Vulpes vulpes (red fox): 112923265
Entry
112923265         CDS       T05911                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04024  cAMP signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04310  Wnt signaling pathway
vvp04330  Notch signaling pathway
vvp04350  TGF-beta signaling pathway
vvp04520  Adherens junction
vvp04630  JAK-STAT signaling pathway
vvp04720  Long-term potentiation
vvp04916  Melanogenesis
vvp04919  Thyroid hormone signaling pathway
vvp04922  Glucagon signaling pathway
vvp04935  Growth hormone synthesis, secretion and action
vvp05016  Huntington disease
vvp05152  Tuberculosis
vvp05161  Hepatitis B
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05206  MicroRNAs in cancer
vvp05211  Renal cell carcinoma
vvp05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112923265 (CREBBP)
   04330 Notch signaling pathway
    112923265 (CREBBP)
   04350 TGF-beta signaling pathway
    112923265 (CREBBP)
   04630 JAK-STAT signaling pathway
    112923265 (CREBBP)
   04066 HIF-1 signaling pathway
    112923265 (CREBBP)
   04068 FoxO signaling pathway
    112923265 (CREBBP)
   04024 cAMP signaling pathway
    112923265 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112923265 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112923265 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112923265 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    112923265 (CREBBP)
   04919 Thyroid hormone signaling pathway
    112923265 (CREBBP)
   04916 Melanogenesis
    112923265 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    112923265 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112923265 (CREBBP)
   05206 MicroRNAs in cancer
    112923265 (CREBBP)
   05203 Viral carcinogenesis
    112923265 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112923265 (CREBBP)
   05215 Prostate cancer
    112923265 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112923265 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112923265 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112923265 (CREBBP)
   05161 Hepatitis B
    112923265 (CREBBP)
   05164 Influenza A
    112923265 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112923265 (CREBBP)
   05165 Human papillomavirus infection
    112923265 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112923265 (CREBBP)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112923265 (CREBBP)
   03029 Mitochondrial biogenesis [BR:vvp03029]
    112923265 (CREBBP)
Enzymes [BR:vvp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     112923265 (CREBBP)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    112923265 (CREBBP)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    112923265 (CREBBP)
Mitochondrial biogenesis [BR:vvp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    112923265 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 112923265
NCBI-ProteinID: XP_025858792
UniProt: A0A3Q7TBW5
LinkDB
Position
Unknown
AA seq 2442 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQTQGQPNSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNNNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLA
ETLTQVSPQMASHAGLNTAQAGGMTKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLSSK
QSMVNSLPPFPTDIKNASVTNVPNMSQMQTSVGIVPTQAIAAGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNAASLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMSDGSSPANIGTLSTLPTAAPPSGTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQAQPVRPPNGPMPLPVNRVQVSQG
MNSFTPMSLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGTHA
NNIMAQAPAQNQFLPQNQFQSSSGAMSVNSVGMGQPAAQTGVPQGQVPGAALPNPLNMLG
PQASQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAPAQVTPQPQTPVQPPSVATPQSSQQQPTPVHPQPP
GTPLSQAAASIDNRVPTPSSVASAETNSQQTGPEVPMLEVKAEVKTEDTEPDASEAKGEP
GSAMMEEDLQGSSQVKEETDTTEQKSEPMEVDEKKPEVKVEAKEEEDNSANGAASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HAHKMVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMS
PAGFPSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRPGMVTPVSQMAPVGLNVPRPNQVSGPVMPNLPPGQWQQAPIPQQQPMPGMPR
PVMSMQAQPAVAGPRMSGVQPPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQL
MAAFIKQRTAKYVASQPGLQPQPGLQPQPSLQAQPGLHQQPGLQNLNAIQAGGPRPGVPP
QQPAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQGSA
GMAGGMAGHGQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQMGQLGQMGQPGLG
ADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLS
SQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHL
GNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7329 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggaggagaattaagccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagctcctgcgcggaggcagcggctct
agtatcaacccaggaataggaaatgttagcgccagcagccccgtgcagcaaggccttggt
ggccagactcaggggcagccgaacagtgcaaacatggccagcttgggtgccatgggcaag
agccctctgaaccagggagattcttcagctcccagcctgcccaaacaggcagccagcacc
tctgggcccactccccctgcttcccaagcactgaatccacaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacatcgcagacgggacctgggatctgcatgaatgctaac
tttaaccagacccacccaggcctcctcaataataactctggccatagtttaatgaaccag
gcccagcaaggacaggcacaagtcatgaacggatctcttggggccgctggcagaggaaga
ggagctgggatgccgtaccctgctccggccatgcagggggccacgagcagcgtgctggct
gagacattaacacaggtttcaccgcaaatggccagtcacgccggactgaatacggcgcag
gccggaggcatgaccaagatgggaatgactggtaacacaagtccatttggacaacccttt
agtcagactggagggcagcaaatgggagcccctggcgtgaacccccagttatccagcaaa
cagagcatggtcaatagtttgcctcccttccctacagacatcaagaatgcttcagtcacc
aacgtgccaaacatgtctcagatgcaaacttcagtgggaatcgtgcccacgcaggcgatt
gcagcaggccccactgcagatcctgagaaacgcaaactgatacagcagcagctggttcta
ctgcttcacgctcataagtgtcagagacgagaacaagcgaacggagaggttcgggcctgc
tctctcccacattgtcgaaccatgaagaacgttttgaatcacatgacacattgtcaggct
gggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtgggattcagaacacaattggttctgtt
ggcacaggccagcagaatgccgcttctttaagtaatccaaatcccatagaccccagctcc
atgcagcgtgcgtacgctgctcttggactcccttacctgaaccagccccagacgcagctg
cagcctcaggttcccggccagcaaccagcacagcctcaaactcaccagcagatgaggact
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccgccaaacttgatttcagaatcagctcttccgacatcccttggggccacaaaccca
ctgatgagcgatggctcaagccctgcaaacattgggactctcagcactctgcctacagcg
gcccctccttccggcactggtgttcggaaaggctggcatgaacacgtcactcaggacctg
cggagccatctagtgcataaactcgtccaagccatctttccaacccctgacccagcagcc
ctaaaggatcgccgcatggagaacctggtggcctacgctaagaaagtggaaggggacatg
tacgagtcagccaacagcagggatgaatactatcacttactggcagaaaaaatctacaag
atacaaaaagaactagaagagaaacggaggtcacgtttgcacaaacaaggcatcttgggt
aaccagcctgccctgccggcccctggggcacagcccccagggattccgcaggcacagcct
gtgaggcctccaaacggacccatgcccctgccagtgaaccgcgtgcaggtgtcccaaggg
atgaattcatttaccccaatgtccttggggaatgtacagttgccacaagctcccatggga
ccacgtgcagcatcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatttctccttcccggatgcctcagcctccgaacatgatgggcactcatgcc
aacaatattatggcccaggcacctgcgcagaaccagttcctgccacagaaccagttccag
tcctccagtggggcgatgagtgtgaacagtgtaggcatggggcagccagcagcccagaca
ggcgtgccacagggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttggg
ccccaggccagccagctgccctgcccaccagtgacacagtcaccattgcaccagacacca
cctcctgcttccacggctgctggcatgccgtctctccagcacccgacggcacctgggatg
actcctccccagcctgcagctcccacccagccatcaactcccgtgtcgtcttccgggcag
actcccaccccgactcctggctcggtgcccagtgcgagccaaacccagagcacccctaca
gtccaggcagcagccccggcccaagtgaccccacagcctcaaaccccagtccagcccccg
tctgtggctaccccgcagtcatcacagcaacagccgacacctgtgcacccccagcctcct
ggcacaccgctttcccaggcagccgccagcatcgataacagggtccccactccttcctcg
gtggccagcgccgaaaccaactcccaacagacaggacccgaggtaccaatgctggaagtg
aaggcagaggtcaagaccgaggacactgagccagatgccagtgaagccaagggggagcct
gggtccgcgatgatggaagaggatctacaaggatcttctcaagttaaagaagagacagac
acaacagaacagaaatcagaaccaatggaagtggacgagaagaagccggaagtcaaagta
gaagctaaagaggaagaagataacagtgctaatggggccgcctctcagtcaacatctcct
tcacagccacgcaaaaaaatctttaagccggaggagttacgccaggctttgatgccaacc
ctcgaagcactatatcgacaggatccagagtcgttacctttccggcagcctgtagacccc
caactcctaggaattccggattactttgacatagtgaagaatcccatggacctttccacc
atcaagcggaagctggacaccgggcagtaccaggagccctggcagtatgtggacgacgtc
tggctgatgttcaacaatgcctggctctataaccgcaagacatcccgggtctacaagttc
tgcagcaaacttgcagaggtcttcgagcaagaaatcgaccccgtcatgcagtcccttggg
tattgctgcggacgcaagtatgagttttccccacagactttgtgctgctacgggaagcag
ctgtgtacaattcctcgtgatgctgcctactacagctatcagaataggtatcatttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacag
ccccagacgacaatttcaaaggatcaatttgaaaagaagaaaaatgataccttagatcct
gaaccttttgtcgattgcaaggagtgcggccggaagatgcatcagatttgtgtgctacac
tatgacatcatttggccttcaggctttgtgtgtgacaactgtttgaagaaaactggcaga
actcggaaagaaaacaagttcagtgctaagagactacagaccacacgattgggcaaccac
ttggaagaccgagtcaacaagtttttgcgacgacagaatcatcctgaagccggggaggtg
tttgtccgtgtggtagccagctcagacaagactgtggaggtcaagcctgggatgaagtca
cggtttgtggattctggggaaatgtctgaatctttcccatatcgaaccaaagcactcttt
gcttttgaggaaattgatggagtggatgtgtgcttcttcgggatgcatgtgcaagagtat
ggctctgattgcccccctccgaacacaaggcgtgtgtacatatcttatctggacagtatt
catttcttccggccccgatgcctccggacagctgtttaccacgagatccttattggatac
ttagaatatgtgaagaaattggggtatgtaacaggacacatctgggcctgccccccaagt
gaaggagacgactatatcttccattgccacccccctgatcagaaaatccccaaaccaaag
cgcctgcaggagtggtacaagaagatgctggacaaggcgtttgcagaacggatcattcac
gactataaggacattttcaaacaggcaactgaagacaggctcaccagtgccaaggagctg
ccctattttgagggtgacttctggcctaatgtgctagaggagagcattaaggagctggag
caagaagaggaggaaaggaagaaggaggagagcactgcggccagtgagaccacagagggc
agccagggcgacagcaagaatgccaagaagaagaacaacaagaaaaccaataagaacaaa
agcagtatcagtcgagccaacaagaagaagcccagcatgcccaacgtgtccaatgacttg
tcccagaagctctatgccacgatggagaagcacaaagaggtcttctttgtcatccacctg
cacgctgggcctgtcatcaacacactgccccccatcgttgaccctgaccccctgcttagc
tgtgacctcatggatgggcgtgacgccttcctcaccctcgccagagacaagcactgggag
ttctcttccttgcgtcggtccaagtggtctacactgtgcatgctggtggagctgcacacc
cagggccaggaccgctttgtctacacctgcaatgagtgcaagcaccacgtggagacacgc
tggcactgcaccgtgtgcgaggactacgacctttgcatcaactgctacaacacgaagagc
catgcccacaagatggtgaagtgggggctgggcctggacgacgagggcggcagccagggc
gagccacagtccaagagcccccaggagtcacggcgcctgagcatccagcgctgcatccag
tccctggtgcatgcctgtcagtgccgcaacgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtacagcacaccaagggctgcaaacgcaagaccaacgggggctgcccg
gtgtgcaagcagctcatcgccctctgctgctaccacgccaaacactgccaagaaaacaaa
tgcccagtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaagctcagctcatgcgccggcggatggccaccatgaacacccgcaatgtg
cctcagcagagtctgccttcccctacctcagctccgcctgggacccccacacagcagccc
agcacaccccagacgccgcagcccccagcccagccccagccctcacccgtgagcatgtca
ccagctggcttccccagcgtggcccggactcagccccccaccacggtgtccaccgggaag
cccaccaaccaggtgccggccccaccgccccctgcccagcctccaccggccgcggtggaa
gcggcccggcagattgagcgtgaggcccagcagcagcagcacctgtaccgggtgaacatc
aacaatggcatgcccccagggcgcccaggcatggtgaccccggtgagccagatggccccc
gtgggcctgaacgtgccccgtcccaaccaggtcagcgggcctgtcatgcccaatctgccg
cccgggcagtggcagcaggcgcccatcccccagcagcagccgatgccaggcatgccgcgg
ccggtgatgtccatgcaggcccagccagctgtggccgggccacggatgtctggcgtgcag
ccaccgccccggagcatctcgcccggcgccctgcaggacctgctgcggaccctgaagtcg
cccagctctccgcagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctg
atggcggcctttatcaagcagcgcacagccaagtacgtggccagtcagcctggcctgcag
ccccagcccggtctgcagccccagcccagcctccaggcccagcccggcctgcaccagcag
cccggcctacaaaacctgaacgccattcaagccggcgggccccggcccggcgtgcccccg
cagcagccggcgatgggaggcctgaacccccagggccaggccctgaacatcatgaacccg
ggccacaaccccagcatggcaagcatgaacccacagtaccgggagatgctccggaggcag
ctgctccagcaacagcagcagcagcagcagcagcaacagcagcagcagcagggcagcgca
ggcatggctgggggcatggccgggcatggccagttccagcagccccaaggacctggaggc
taccccccagccatgcagcagcagcggatgcagcagcacctccccatccagggcagctcc
atgggccagatggcggctcagatgggacagctcggccaaatggggcagccggggctgggg
gcagacagcacccctaacatccagcaggccctgcagcagcggattctgcagcagcagcag
atgaagcagcagatcgggtccccgggccagccgaaccccatgagcccccagcagcacatg
ctctcaggacagccacaggcctcgcacctccccggccagcagatggccacatccctcagt
agccaggtgcggtctccggcccctgtccagtctccgcggccccagtcccagcctccacat
tccagcccgtcgccacggatacagccccagccttcgccacaccatgtgtcgccccagact
ggttccccccacccaggactcgcagtcaccatggccagctccatagatcagggacacttg
gggaaccccgaacagagtgcaatgctcccacagctgaacacccccaacaggagtgcgttg
tccagtgagctgtccctggtcggcgacaccacaggagacaccctagaaaagtttgtggag
ggtttgtag

KEGG   Vulpes vulpes (red fox): 112934069
Entry
112934069         CDS       T05911                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300 isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04024  cAMP signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04310  Wnt signaling pathway
vvp04330  Notch signaling pathway
vvp04350  TGF-beta signaling pathway
vvp04520  Adherens junction
vvp04630  JAK-STAT signaling pathway
vvp04720  Long-term potentiation
vvp04916  Melanogenesis
vvp04919  Thyroid hormone signaling pathway
vvp04922  Glucagon signaling pathway
vvp04935  Growth hormone synthesis, secretion and action
vvp05016  Huntington disease
vvp05152  Tuberculosis
vvp05161  Hepatitis B
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05206  MicroRNAs in cancer
vvp05211  Renal cell carcinoma
vvp05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112934069 (EP300)
   04330 Notch signaling pathway
    112934069 (EP300)
   04350 TGF-beta signaling pathway
    112934069 (EP300)
   04630 JAK-STAT signaling pathway
    112934069 (EP300)
   04066 HIF-1 signaling pathway
    112934069 (EP300)
   04068 FoxO signaling pathway
    112934069 (EP300)
   04024 cAMP signaling pathway
    112934069 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112934069 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112934069 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112934069 (EP300)
   04935 Growth hormone synthesis, secretion and action
    112934069 (EP300)
   04919 Thyroid hormone signaling pathway
    112934069 (EP300)
   04916 Melanogenesis
    112934069 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    112934069 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112934069 (EP300)
   05206 MicroRNAs in cancer
    112934069 (EP300)
   05203 Viral carcinogenesis
    112934069 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112934069 (EP300)
   05215 Prostate cancer
    112934069 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112934069 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112934069 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112934069 (EP300)
   05161 Hepatitis B
    112934069 (EP300)
   05164 Influenza A
    112934069 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112934069 (EP300)
   05165 Human papillomavirus infection
    112934069 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112934069 (EP300)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112934069 (EP300)
   03029 Mitochondrial biogenesis [BR:vvp03029]
    112934069 (EP300)
Enzymes [BR:vvp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     112934069 (EP300)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    112934069 (EP300)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    112934069 (EP300)
Mitochondrial biogenesis [BR:vvp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    112934069 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1 MSP1b
Other DBs
NCBI-GeneID: 112934069
NCBI-ProteinID: XP_025873213
UniProt: A0A3Q7TTQ4
LinkDB
Position
Unknown
AA seq 2430 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQPQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSAAGMMNSPVNQPAMGMNTGMNAGMNPGMLN
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGSLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYSQNSGQQIGAGGLGLQIQTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAPGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPAQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMNENASVASLGPMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPQPMGYGPRMQQPSSQSQFLPQTQFSTQGMNV
TNMPLAPTGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQSALHQNSPSPVPS
RTPTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQTQALHPPPRQTPTPPPTQLPPQV
QPSLPPAPSADQPQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPST
SSTEVNSQTIPEKQPSQEVKMEAKMEVDPPEPADTQPEDIPETKAEDCKMEPTETEERGT
ELKTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQ
PVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSR
VYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNR
YHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQI
CVLHHEIIWPSGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPE
SGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMH
VQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWA
CPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTS
AKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTS
KNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDP
LIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHV
ETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQR
CIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQ
ENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTT
PTGQQPTTPQTPQPQPPSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQ
PPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARG
PSGHLEPGMGPTGMQQQPQWVQGGLPQPQQLQPGMPRPAMMSVAQHGQPLNIAPQPGLGQ
VGVSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANS
NPQPLPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMPNMNPMQAGVQRAGLPQQQPQQQLQ
PPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQQQQGAGPGLGPGMANHNQFQ
QPQGVGYPPPPPPPQQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRL
LQQQMGSPAQPNPMSPQQHMLPSQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPH
SSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQSSMLSQLASNPGMAN
LHGASATDLGLSTDNSDLNSNLSQSTLDIH
NT seq 7293 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgacggcacagattttggctctctatttgatttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccagccccaacagaacagtcctggattaggtttgataaatagc
atggttaaaagcccaatggcgcaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcctacgccatctgcagcaggtatgatgaacagtccagtaaat
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgaat
gcaggcaatggacaggggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcagtttaatg
accgagccactacagcaaggctctcctcagatgggaggacaaacgggattgagaggccct
cagcctcttaagatgggaatgatgaacaaccctaatccttatggttcaccgtacagtcag
aattctggacagcagattggagccggtggccttggtctccagattcagacaaagtccgta
ctaccaaatagcttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggtcagcagcaggccccacaggtccagcagccaggccttgtgactccagtg
gccccagggatgggttctggggcacacacagctgatccagagaagcgcaagctcatccag
cagcagcttgttctccttttgcatgctcataagtgccagcgccgggagcaggctaatggg
gaagtgaggcagtgtaaccttccccactgccgcacgatgaagaacgtcctgaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtctcccccttaaaaat
gctggagataagagaaatcaacagtcaattctgactggagcaccagttggacttggaaat
actagctctctaggagtgggtcaacagtctacccccagcctaagcactgttagtcagatt
gatcccagctctatagaaagggcctatgcagctcttgggctgccctatcaagtaaatcag
atgccggcacagccccaggtgcaagcaaagaaccagcagaatcagcagtctgggcagtct
ccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcagacatcaaatcttctgtctgactcaatgttgcattcagccataaattct
caaaacccaatgatgaatgaaaatgccagtgtggcctccctgggtcctatgccaacagca
gctcaaccatccaatactggaattcggaaacaatggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacggatggaaaacttagttgcatacgcccggaaagtggaaggggacatg
tatgaatcggcaaataatcgagcggaatactaccacctgctagctgagaagatctataag
atccagaaagaactagaagaaaaacgaaggactagactacagaaacaaaacatgctaccc
agtgctgcaggcatggtgccagtttctatgaatccagggcccaatatggggcagccacaa
ccaggaatgacttccaatggccctcttcctgacccatctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccacagcctggtttgaatcagtttggccagatgagt
atgcctcagcccccaattggaccccggcaaacctctcctcttcagcaccatggacagtta
gctcagcctggaactctaaacccaccgcagcctatgggctatgggcctcgcatgcagcag
ccttccagccagagccaattccttccccagactcagttctcaacacaggggatgaatgta
acgaatatgcctttggctccgactggcggccaagcaccagtgtctcaagcacaaatgtcc
agttcttcctgccccgtgaactctcctataatgccaccagggtctcaagggagccacatt
cactgtccccctcttcctcaatcagctctacatcagaattcaccctccccggtacctagt
cgcacccccacgcctcaccacactcccccaagcataggggctcagcagccaccagcaaca
gcaattccagcccctgttcctacacctccagccatgccacctgggccacagacccaagct
ttacatccacctccaaggcagacacccacaccaccaccaacgcagcttcctcctcaagtt
cagccttcacttcctcctgctccttcagctgaccagccacagcagcagcctctctcacag
cagagtacagcagcgtctgttcccaccccgacggcgccgctgctgcccccgcagcctgca
actccactttcccagccagctgtaagcattgaagggcaggtatcaaaccctccatccact
agtagcacagaagtcaattctcagaccattcctgagaagcagccttcacaggaagtgaaa
atggaggctaagatggaagtggatccaccagaaccagcagatactcagccagaggatatt
ccagagactaaagcagaggactgtaaaatggaacctacagaaacagaagaaagaggcact
gaattaaaaactgaaacaaaagaggaggaagaccagccaagtacttcagctacccagtct
tctccagccccaggacagtcaaagaagaagattttcaagccagaagagttacgacaggca
ctgatgccaacattggaggcactttaccgacaggatccagaatcccttccctttcgtcag
cctgtggaccctcaacttctaggaatccctgattactttgatattgtgaagagccccatg
gacctttctaccatcaagagaaagttagacactggacagtatcaggagccctggcagtat
gtggatgacatttggcttatgttcaacaatgcctggttgtataatcgaaagacatcacgg
gtatacaaatactgctccaagctgtctgaggtctttgaacaagaaattgacccagtaatg
caaagccttggatattgctgtggcagaaagttggagttttctccacagacactctgttgc
tatggcaaacagttatgcacaatccctcgagatgccacttactacagttaccagaacagg
tatcatttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggat
gacccttcccagccacaaactacaataaataaagaacaattttccaagagaaaaaatgac
acactggatcccgaactgtttgttgaatgtacagagtgtggaagaaagatgcatcagatc
tgtgtccttcatcatgaaatcatctggccatctggatttgtctgtgatggctgtttaaag
aaatcagcacgaaccaggaaagaaaataagttttctgctaaaaggttgccatctaccagg
cttggcacctttctggagaatcgtgtgaatgattttcttagacgtcagaatcaccctgag
tcgggagaagtcactgttcgggtagtgcatgcttctgataaaactgtggaagtgaaacca
ggcatgaaagcaaggtttgtagatagcggagagatggcagagtcttttccttaccgaacc
aaagccctctttgcctttgaagagatagacggtgttgacttgtgcttcttcggcatgcac
gttcaggagtatggctccgactgccctccacccaaccagaggagagtttacatatcctac
cttgacagtgttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatt
ctaattggatatttagaatacgtcaagaaattagggtatacaacagggcatatttgggca
tgtcccccaagtgagggagacgactatatcttccattgccatcctcctgaccagaagata
cccaagcccaagcgactacaggagtggtacaaaaagatgcttgacaaggctgtgtctgag
cgaatcgtccatgactacaaggatatttttaaacaagctactgaagatcgattaacaagt
gcaaaggagttgccttactttgagggtgatttctggcccaacgttctggaagagagcatt
aaggagctagaacaggaggaagaagagcgaaagcgagaagaaaacaccagcaacgagagc
acagatgtgacaaagggagacagcaaaaatgctaaaaagaaaaataataagaaaaccagc
aaaaacaagagcagcctgagtaggggcaacaagaagaagccgggcatgcccaatgtgtcc
aatgacctctcgcaaaaactgtatgccaccatggagaagcacaaagaggtcttctttgtg
atccgtctcatcgctggccctgccgccaactccctgcctcccatcgttgatcctgacccc
ctcatcccttgcgatctgatggatgggcgggacgccttccttaccctcgccagggacaag
cacctggagttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggag
ctgcacacccagagccaggaccgttttgtctacacctgcaacgagtgcaagcaccatgtg
gagacccgctggcactgcactgtctgtgaggattatgatttatgtatcacctgctataac
actaaaaaccatgaccacaaaatggagaaactaggtcttggcttagacgacgagagcaac
agccagcaggctgcagccacccaaagcccaggagactcccgccgcctgagcatccagcgc
tgcattcagtccctggtgcatgcctgccagtgccggaacgccaactgctcactgccctcc
tgccagaagatgaagcgggtggtacagcacaccaagggctgcaaacggaagaccaacggg
ggctgccccatctgcaagcagctcatcgccctctgctgctaccacgccaaacactgccag
gagaacaagtgccctgtgcccttctgcctcaacatcaagcaaaagctccggcaacagcag
ctgcagcaccggctccagcaggctcagatgctccgcaggaggatggccagtatgcagcgg
accggggtggtggggcagcagcaaggcctgccttccccaactcctgccactccaaccaca
ccaactggtcaacaaccaaccaccccgcagacaccccagccccagcctccctctcagccc
cagcccactcctcccaacagcatgccaccctacttgcccaggactcaggctgctggcccc
gtctcccagggtaaggcagcaggccaggtgacccctcccactccccctcagactgctcag
ccaccccttccagggcccccacctgctgcagtggaaatggcaatgcagattcagagggca
gctgagacgcagcgccagatggcccacgtgcaaatttttcaaaggccaatccagcaccag
atgccccagatgactccaatggcccccatgggtatgaacccaccccctatggccagaggt
cccagtgggcatttggagccagggatggggcccaccgggatgcagcagcagccacagtgg
gtccagggaggtttgcctcagccccagcagctacagcctgggatgccgaggccagccatg
atgtcagtggcccagcatggtcaacccttgaatatagctccccagccaggactgggccag
gtaggtgtgagccctctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttg
cggactctcaggtctcccagctctcccctacagcagcaacaggtgcttagtatccttcat
gccaacccccagctgttggctgcattcatcaagcagcgggctgccaagtatgccaactcg
aatccacagcccctccctgggcagcctggcatgccccagggccagcccgggctgcagccg
cctaccatgccaggccagcagggggtccactctaatccagccatgccgaacatgaatccc
atgcaagcaggcgtccagagggccggcctgccccagcagcagccgcagcagcaactccag
ccacccatgggagggatgagcccccaagctcagcaaatgaacatgaatcacaacaccatg
ccttcacagttccgagacatcctgaggcggcagcagatgatgcagcagcaacagcagcag
cagcagcagggagcagggcctggactcggccccgggatggccaaccataaccagttccag
caaccccaaggagttggctaccccccaccaccaccgccgccacagcagcagcagcagcaa
cagcggatgcaacatcacatgcagcagatgcagcaagggaacatgggacagatgggccag
ctcccccaggccttgggagcagaggctggagcaagtttgcaggcgtatcagcagcgactc
ctccagcaacagatggggtcccctgctcagcccaaccccatgagcccccagcagcatatg
ctcccaagccaggctcagtccccacacctccaaggccagcagatcccttcttctctctcc
aatcaagtgcgctctccccagcccgtcccttctccacggccgcagtcccagcctccccac
tccagcccttccccgaggatgcagcctcagccctctccgcaccatgtctccccacagacc
agttctccacatcccggactggtagctgcccaggccaaccccatggaacaagggcatttt
gccagcccggaccagagttcaatgctctctcagctcgctagcaatccaggcatggcaaac
ctccatggtgcaagtgccacggacctgggactcagcaccgataactcagacttgaattcg
aacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system