KEGG   Vulpes vulpes (red fox): 112923476
Entry
112923476         CDS       T05911                                 

Gene name
GORAB
Definition
(RefSeq) RAB6-interacting golgin isoform X1
  KO
K19748  RAB6-interacting golgin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112923476 (GORAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112923476 (GORAB)
Membrane trafficking [BR:vvp04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    112923476 (GORAB)
SSDB
Motif
Pfam: Transcrip_act
Other DBs
NCBI-GeneID: 112923476
NCBI-ProteinID: XP_025859101
UniProt: A0A3Q7STL0
LinkDB
Position
Unknown
AA seq 397 aa
MCPGSRVGSRGSEVWALWGCWQPRPMARGWAGFSEEELRRLRQTKDPFEPQRRLPVKKSR
QQLQREKALQEQSQKLGLQEGSTSVPPEQLLSTPKPSFNSPKPHSSPPVPPSPLTLISPV
GNGKPQGIESQPRELGFENSHDSHKNTEVLPPEPDCKMEKKKVELQEKSRWEVLQQEQRL
MEEKNKRKKALLAKAIAERSKRTQAEALKLKRIQKELQALDDMVSADIGILRNRIDQASL
EYSYARKRFDRAEAEYVTAKLDLQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMHQLD
VQADEETLELEVEVERLLCEQEAEAGKQIVHLERPFQPSAECVTSGFAKENKNPQEHTAS
LKVDEQYENPNSNPLLNPDQSQEVKTTVKAISAALTT
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtgcccgggtagtcgtgttggcagtcggggctctgaggtttgggcgctctgggggtgc
tggcagccgaggccaatggcgcggggttgggcaggcttctctgaggaggagctgaggcgg
ctaaggcagactaaagacccatttgaaccacagcggcgtcttcctgtgaagaaaagtcga
caacaacttcagcgagaaaaagcccttcaagagcagagccaaaaacttggacttcaagag
ggatcaacctcagtacctccagagcagttgctttccacaccaaaaccaagttttaatagt
ccaaaaccacattcttctccccctgttcctcctagtcctctgacactcatctctcctgtt
ggtaatggaaaaccacagggtattgaaagtcaaccaagggaactaggattcgagaattcc
catgatagtcacaaaaacaccgaggttctacccccagagccagattgcaaaatggaaaaa
aagaaagtggaattgcaagaaaaatctcgttgggaagtcctccaacaagagcaacggcta
atggaagagaaaaataaacgtaagaaagctcttttggctaaagctattgcagaaagatct
aaaagaactcaagcagaggccttgaaactaaagcggattcaaaaagagttacaggctcta
gatgacatggtgtcagctgacattggaatccttagaaaccggattgatcaggccagcctc
gagtattcatatgctcggaagcgctttgacagggccgaagcagagtatgttacagcaaag
ctagatctgcagcgcaagactgagattaaagagcaactcactgaacacctctgtacaatt
atacaacagaatgaactccgcaaggccaagaagttggaggaattgatgcaccaactggat
gtacaagctgatgaggagactttggagcttgaggtggaagtggaaagattgctatgtgaa
caagaagctgaagcggggaagcaaattgttcatttggagaggccatttcagccttctgca
gagtgtgtcacatcaggatttgccaaagagaacaaaaatcctcaagaacacaccgcttcc
ctaaaggtagatgaacagtatgaaaatcctaatagcaatccccttctaaatccagaccaa
agtcaagaagtcaaaactactgtaaaggccatttcagctgctctgaccacatga

DBGET integrated database retrieval system