KEGG   Vulpes vulpes (red fox): 112923528
Entry
112923528         CDS       T05911                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04370  VEGF signaling pathway
vvp04371  Apelin signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04728  Dopaminergic synapse
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04922  Glucagon signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04973  Carbohydrate digestion and absorption
vvp05010  Alzheimer disease
vvp05017  Spinocerebellar ataxia
vvp05132  Salmonella infection
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112923528 (AKT3)
   04012 ErbB signaling pathway
    112923528 (AKT3)
   04014 Ras signaling pathway
    112923528 (AKT3)
   04015 Rap1 signaling pathway
    112923528 (AKT3)
   04370 VEGF signaling pathway
    112923528 (AKT3)
   04371 Apelin signaling pathway
    112923528 (AKT3)
   04630 JAK-STAT signaling pathway
    112923528 (AKT3)
   04668 TNF signaling pathway
    112923528 (AKT3)
   04066 HIF-1 signaling pathway
    112923528 (AKT3)
   04068 FoxO signaling pathway
    112923528 (AKT3)
   04072 Phospholipase D signaling pathway
    112923528 (AKT3)
   04071 Sphingolipid signaling pathway
    112923528 (AKT3)
   04024 cAMP signaling pathway
    112923528 (AKT3)
   04022 cGMP-PKG signaling pathway
    112923528 (AKT3)
   04151 PI3K-Akt signaling pathway
    112923528 (AKT3)
   04152 AMPK signaling pathway
    112923528 (AKT3)
   04150 mTOR signaling pathway
    112923528 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112923528 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    112923528 (AKT3)
   04218 Cellular senescence
    112923528 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112923528 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    112923528 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112923528 (AKT3)
   04613 Neutrophil extracellular trap formation
    112923528 (AKT3)
   04620 Toll-like receptor signaling pathway
    112923528 (AKT3)
   04625 C-type lectin receptor signaling pathway
    112923528 (AKT3)
   04660 T cell receptor signaling pathway
    112923528 (AKT3)
   04662 B cell receptor signaling pathway
    112923528 (AKT3)
   04664 Fc epsilon RI signaling pathway
    112923528 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    112923528 (AKT3)
   04062 Chemokine signaling pathway
    112923528 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112923528 (AKT3)
   04922 Glucagon signaling pathway
    112923528 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    112923528 (AKT3)
   04920 Adipocytokine signaling pathway
    112923528 (AKT3)
   04929 GnRH secretion
    112923528 (AKT3)
   04915 Estrogen signaling pathway
    112923528 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    112923528 (AKT3)
   04917 Prolactin signaling pathway
    112923528 (AKT3)
   04926 Relaxin signaling pathway
    112923528 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    112923528 (AKT3)
   04919 Thyroid hormone signaling pathway
    112923528 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112923528 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112923528 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    112923528 (AKT3)
   04728 Dopaminergic synapse
    112923528 (AKT3)
   04722 Neurotrophin signaling pathway
    112923528 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112923528 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    112923528 (AKT3)
   04213 Longevity regulating pathway - multiple species
    112923528 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112923528 (AKT3)
   05205 Proteoglycans in cancer
    112923528 (AKT3)
   05230 Central carbon metabolism in cancer
    112923528 (AKT3)
   05231 Choline metabolism in cancer
    112923528 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112923528 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112923528 (AKT3)
   05212 Pancreatic cancer
    112923528 (AKT3)
   05225 Hepatocellular carcinoma
    112923528 (AKT3)
   05226 Gastric cancer
    112923528 (AKT3)
   05214 Glioma
    112923528 (AKT3)
   05221 Acute myeloid leukemia
    112923528 (AKT3)
   05220 Chronic myeloid leukemia
    112923528 (AKT3)
   05218 Melanoma
    112923528 (AKT3)
   05211 Renal cell carcinoma
    112923528 (AKT3)
   05215 Prostate cancer
    112923528 (AKT3)
   05213 Endometrial cancer
    112923528 (AKT3)
   05224 Breast cancer
    112923528 (AKT3)
   05222 Small cell lung cancer
    112923528 (AKT3)
   05223 Non-small cell lung cancer
    112923528 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112923528 (AKT3)
   05017 Spinocerebellar ataxia
    112923528 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112923528 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112923528 (AKT3)
   04931 Insulin resistance
    112923528 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112923528 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112923528 (AKT3)
   05135 Yersinia infection
    112923528 (AKT3)
   05152 Tuberculosis
    112923528 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112923528 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    112923528 (AKT3)
   05161 Hepatitis B
    112923528 (AKT3)
   05160 Hepatitis C
    112923528 (AKT3)
   05164 Influenza A
    112923528 (AKT3)
   05162 Measles
    112923528 (AKT3)
   05168 Herpes simplex virus 1 infection
    112923528 (AKT3)
   05163 Human cytomegalovirus infection
    112923528 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112923528 (AKT3)
   05169 Epstein-Barr virus infection
    112923528 (AKT3)
   05165 Human papillomavirus infection
    112923528 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112923528 (AKT3)
   05142 Chagas disease
    112923528 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112923528 (AKT3)
   01524 Platinum drug resistance
    112923528 (AKT3)
   01522 Endocrine resistance
    112923528 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112923528 (AKT3)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112923528 (AKT3)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112923528 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 112923528
NCBI-ProteinID: XP_025859189
UniProt: A0A3Q7SEW5
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccgttgtgaaagaaggctgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagagtggacagaa
gctattcaggcggtagcagacagacttcagagacaagaagaagagagaatgaattgtagt
ccaacttcacaaattgataatataggggaggaagagatggatgcttccacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtgggaaatactatgctatgaagattctgaag
aaagaagtgattattgcaaaggatgaagtggcacatactctaacggaaagcagagtgtta
aagaatactcgacacccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggattacagatgca
gccaccatgaagacattctgtggcacaccagagtatctggcaccagaggtgttagaagac
aatgactatggccgagccgtggattggtggggactgggggtcgtcatgtatgaaatgatg
tgtgggaggttacctttctacaatcaggatcatgagaagctttttgaactaatactaatg
gaagacattaaattccctcgaacactctcttcagatgcaaaatcattgctttcggggctc
ttgataaaggatccaaataaacgccttggtgggggcccagatgatgcaaaagaaattatg
aggcacagtttcttctctggagtcaactggcaagatgtatacgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatatttcgatgaagaatttaca
gcgcagactattacaataacaccacctgaaaagtatgacgaggacggtatggactgcgtg
gacaacgagcggcggccgcacttccctcagttctcctactccgccagcggccgggagtaa

KEGG   Vulpes vulpes (red fox): 112928376
Entry
112928376         CDS       T05911                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04370  VEGF signaling pathway
vvp04371  Apelin signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04728  Dopaminergic synapse
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04922  Glucagon signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04973  Carbohydrate digestion and absorption
vvp05010  Alzheimer disease
vvp05017  Spinocerebellar ataxia
vvp05132  Salmonella infection
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112928376 (AKT2)
   04012 ErbB signaling pathway
    112928376 (AKT2)
   04014 Ras signaling pathway
    112928376 (AKT2)
   04015 Rap1 signaling pathway
    112928376 (AKT2)
   04370 VEGF signaling pathway
    112928376 (AKT2)
   04371 Apelin signaling pathway
    112928376 (AKT2)
   04630 JAK-STAT signaling pathway
    112928376 (AKT2)
   04668 TNF signaling pathway
    112928376 (AKT2)
   04066 HIF-1 signaling pathway
    112928376 (AKT2)
   04068 FoxO signaling pathway
    112928376 (AKT2)
   04072 Phospholipase D signaling pathway
    112928376 (AKT2)
   04071 Sphingolipid signaling pathway
    112928376 (AKT2)
   04024 cAMP signaling pathway
    112928376 (AKT2)
   04022 cGMP-PKG signaling pathway
    112928376 (AKT2)
   04151 PI3K-Akt signaling pathway
    112928376 (AKT2)
   04152 AMPK signaling pathway
    112928376 (AKT2)
   04150 mTOR signaling pathway
    112928376 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112928376 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    112928376 (AKT2)
   04218 Cellular senescence
    112928376 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112928376 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    112928376 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112928376 (AKT2)
   04613 Neutrophil extracellular trap formation
    112928376 (AKT2)
   04620 Toll-like receptor signaling pathway
    112928376 (AKT2)
   04625 C-type lectin receptor signaling pathway
    112928376 (AKT2)
   04660 T cell receptor signaling pathway
    112928376 (AKT2)
   04662 B cell receptor signaling pathway
    112928376 (AKT2)
   04664 Fc epsilon RI signaling pathway
    112928376 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    112928376 (AKT2)
   04062 Chemokine signaling pathway
    112928376 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112928376 (AKT2)
   04922 Glucagon signaling pathway
    112928376 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    112928376 (AKT2)
   04920 Adipocytokine signaling pathway
    112928376 (AKT2)
   04929 GnRH secretion
    112928376 (AKT2)
   04915 Estrogen signaling pathway
    112928376 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    112928376 (AKT2)
   04917 Prolactin signaling pathway
    112928376 (AKT2)
   04926 Relaxin signaling pathway
    112928376 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    112928376 (AKT2)
   04919 Thyroid hormone signaling pathway
    112928376 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112928376 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112928376 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    112928376 (AKT2)
   04728 Dopaminergic synapse
    112928376 (AKT2)
   04722 Neurotrophin signaling pathway
    112928376 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112928376 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    112928376 (AKT2)
   04213 Longevity regulating pathway - multiple species
    112928376 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112928376 (AKT2)
   05205 Proteoglycans in cancer
    112928376 (AKT2)
   05230 Central carbon metabolism in cancer
    112928376 (AKT2)
   05231 Choline metabolism in cancer
    112928376 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112928376 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112928376 (AKT2)
   05212 Pancreatic cancer
    112928376 (AKT2)
   05225 Hepatocellular carcinoma
    112928376 (AKT2)
   05226 Gastric cancer
    112928376 (AKT2)
   05214 Glioma
    112928376 (AKT2)
   05221 Acute myeloid leukemia
    112928376 (AKT2)
   05220 Chronic myeloid leukemia
    112928376 (AKT2)
   05218 Melanoma
    112928376 (AKT2)
   05211 Renal cell carcinoma
    112928376 (AKT2)
   05215 Prostate cancer
    112928376 (AKT2)
   05213 Endometrial cancer
    112928376 (AKT2)
   05224 Breast cancer
    112928376 (AKT2)
   05222 Small cell lung cancer
    112928376 (AKT2)
   05223 Non-small cell lung cancer
    112928376 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112928376 (AKT2)
   05017 Spinocerebellar ataxia
    112928376 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112928376 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112928376 (AKT2)
   04931 Insulin resistance
    112928376 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112928376 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112928376 (AKT2)
   05135 Yersinia infection
    112928376 (AKT2)
   05152 Tuberculosis
    112928376 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112928376 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    112928376 (AKT2)
   05161 Hepatitis B
    112928376 (AKT2)
   05160 Hepatitis C
    112928376 (AKT2)
   05164 Influenza A
    112928376 (AKT2)
   05162 Measles
    112928376 (AKT2)
   05168 Herpes simplex virus 1 infection
    112928376 (AKT2)
   05163 Human cytomegalovirus infection
    112928376 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112928376 (AKT2)
   05169 Epstein-Barr virus infection
    112928376 (AKT2)
   05165 Human papillomavirus infection
    112928376 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112928376 (AKT2)
   05142 Chagas disease
    112928376 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112928376 (AKT2)
   01524 Platinum drug resistance
    112928376 (AKT2)
   01522 Endocrine resistance
    112928376 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112928376 (AKT2)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112928376 (AKT2)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112928376 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 112928376
NCBI-ProteinID: XP_025865819
UniProt: A0A3Q7TKI8
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDPSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAREVMEHRFFLSVSWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccataagcgtggtgaatacatcaag
acctggaggccccggtacttcctgttgaagagtgacggctcctttattggatacaaggag
cggcctgacgcccctgaccagaccctgccccccctgaacaacttctctgtcgcagaatgc
cagctgatgaagactgagaggccacggcccaacacctttgtcatacgctgcttgcagtgg
accactgtcatcgagaggaccttccacgtagactctccagatgagagggaggagtggatg
cgggccattcagatggtcgccaacagcctcaagcagcggggcccgggtgaggaccccatg
gactataagtgtggctctcccagtgacccttctgcggctgaggagatggaagtggcagtt
agcaaggctcgggccaaggtgaccatgaatgacttcgactatctcaaacttctgggcaag
ggcacctttggcaaagtgattctggtgcgggaaaaggccagtggccgctactacgccatg
aagatcctgcggaaggaagttatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgcgtcctccagaacaccaggcacccatttctcaccgccctgaagtacgccttccag
acccatgaccgcttgtgcttcgtgatggagtatgccaatggtggtgagctgtttttccac
ctgtcccgggagcgtgtcttcacggaggagcgggctcgcttttatggcgcagagatcgtc
tctgccctcgagtatttgcattcgagggatgtggtgtaccgtgacatcaagctggaaaac
ctcatgctggacaaagatggccatatcaagatcactgacttcggcctgtgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggacgcccgagtacctggcacctgag
gtgctggaagacaacgactacggccgcgcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacactcagccccgaggccaagtccctg
cttgccgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagcgacgcc
agggaggtcatggagcacaggttcttcctcagcgtcagctggcaggacgtggtacagaag
aagcttctgccacccttcaagcctcaggtcacctctgaggttgacaccaggtactttgac
gacgagttcaccgcccagtccatcacaatcacgcccccggaccgctatgacagcctgggc
tccctcgaactggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Vulpes vulpes (red fox): 112930303
Entry
112930303         CDS       T05911                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04370  VEGF signaling pathway
vvp04371  Apelin signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04728  Dopaminergic synapse
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04922  Glucagon signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04973  Carbohydrate digestion and absorption
vvp05010  Alzheimer disease
vvp05017  Spinocerebellar ataxia
vvp05132  Salmonella infection
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112930303 (AKT1)
   04012 ErbB signaling pathway
    112930303 (AKT1)
   04014 Ras signaling pathway
    112930303 (AKT1)
   04015 Rap1 signaling pathway
    112930303 (AKT1)
   04370 VEGF signaling pathway
    112930303 (AKT1)
   04371 Apelin signaling pathway
    112930303 (AKT1)
   04630 JAK-STAT signaling pathway
    112930303 (AKT1)
   04668 TNF signaling pathway
    112930303 (AKT1)
   04066 HIF-1 signaling pathway
    112930303 (AKT1)
   04068 FoxO signaling pathway
    112930303 (AKT1)
   04072 Phospholipase D signaling pathway
    112930303 (AKT1)
   04071 Sphingolipid signaling pathway
    112930303 (AKT1)
   04024 cAMP signaling pathway
    112930303 (AKT1)
   04022 cGMP-PKG signaling pathway
    112930303 (AKT1)
   04151 PI3K-Akt signaling pathway
    112930303 (AKT1)
   04152 AMPK signaling pathway
    112930303 (AKT1)
   04150 mTOR signaling pathway
    112930303 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112930303 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    112930303 (AKT1)
   04218 Cellular senescence
    112930303 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112930303 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112930303 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112930303 (AKT1)
   04613 Neutrophil extracellular trap formation
    112930303 (AKT1)
   04620 Toll-like receptor signaling pathway
    112930303 (AKT1)
   04625 C-type lectin receptor signaling pathway
    112930303 (AKT1)
   04660 T cell receptor signaling pathway
    112930303 (AKT1)
   04662 B cell receptor signaling pathway
    112930303 (AKT1)
   04664 Fc epsilon RI signaling pathway
    112930303 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    112930303 (AKT1)
   04062 Chemokine signaling pathway
    112930303 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112930303 (AKT1)
   04922 Glucagon signaling pathway
    112930303 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    112930303 (AKT1)
   04920 Adipocytokine signaling pathway
    112930303 (AKT1)
   04929 GnRH secretion
    112930303 (AKT1)
   04915 Estrogen signaling pathway
    112930303 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    112930303 (AKT1)
   04917 Prolactin signaling pathway
    112930303 (AKT1)
   04926 Relaxin signaling pathway
    112930303 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    112930303 (AKT1)
   04919 Thyroid hormone signaling pathway
    112930303 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112930303 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112930303 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    112930303 (AKT1)
   04728 Dopaminergic synapse
    112930303 (AKT1)
   04722 Neurotrophin signaling pathway
    112930303 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112930303 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    112930303 (AKT1)
   04213 Longevity regulating pathway - multiple species
    112930303 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112930303 (AKT1)
   05205 Proteoglycans in cancer
    112930303 (AKT1)
   05230 Central carbon metabolism in cancer
    112930303 (AKT1)
   05231 Choline metabolism in cancer
    112930303 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112930303 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112930303 (AKT1)
   05212 Pancreatic cancer
    112930303 (AKT1)
   05225 Hepatocellular carcinoma
    112930303 (AKT1)
   05226 Gastric cancer
    112930303 (AKT1)
   05214 Glioma
    112930303 (AKT1)
   05221 Acute myeloid leukemia
    112930303 (AKT1)
   05220 Chronic myeloid leukemia
    112930303 (AKT1)
   05218 Melanoma
    112930303 (AKT1)
   05211 Renal cell carcinoma
    112930303 (AKT1)
   05215 Prostate cancer
    112930303 (AKT1)
   05213 Endometrial cancer
    112930303 (AKT1)
   05224 Breast cancer
    112930303 (AKT1)
   05222 Small cell lung cancer
    112930303 (AKT1)
   05223 Non-small cell lung cancer
    112930303 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112930303 (AKT1)
   05017 Spinocerebellar ataxia
    112930303 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112930303 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112930303 (AKT1)
   04931 Insulin resistance
    112930303 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112930303 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112930303 (AKT1)
   05135 Yersinia infection
    112930303 (AKT1)
   05152 Tuberculosis
    112930303 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112930303 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    112930303 (AKT1)
   05161 Hepatitis B
    112930303 (AKT1)
   05160 Hepatitis C
    112930303 (AKT1)
   05164 Influenza A
    112930303 (AKT1)
   05162 Measles
    112930303 (AKT1)
   05168 Herpes simplex virus 1 infection
    112930303 (AKT1)
   05163 Human cytomegalovirus infection
    112930303 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112930303 (AKT1)
   05169 Epstein-Barr virus infection
    112930303 (AKT1)
   05165 Human papillomavirus infection
    112930303 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112930303 (AKT1)
   05142 Chagas disease
    112930303 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112930303 (AKT1)
   01524 Platinum drug resistance
    112930303 (AKT1)
   01522 Endocrine resistance
    112930303 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112930303 (AKT1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112930303 (AKT1)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112930303 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 APH Pkinase_fungal
Other DBs
NCBI-GeneID: 112930303
NCBI-ProteinID: XP_025868463
UniProt: A0A3Q7TFF3
LinkDB
Position
Unknown
AA seq 516 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGEVGWPRR
AWRWPRALGSPPGRQGLGPQPAHPHALVPQLFFHLSRERVFPEDRARFYGAEIVSALDYL
HSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDN
DYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFELILMEELRFPRTLSPEAKSLLSGLL
KKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKKLSPPFKPQVTSETDTRYFDEEFTA
QMITITPPDQGDNMEGEDSERRPHFPQFSYSASGTA
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggttggctgcacaagagaggggagtacatcaaa
acctggcggccccggtacttcctcctcaagaacgacggcacgttcatcggctacaaggag
cggccccaggatgtggagcagcgagagtcccccctcaacaacttctccgtggcacaatgt
cagctgatgaagactgagcggcccaggcccaacaccttcatcatccgttgcctgcagtgg
accacggtcattgagcgcaccttccacgtggagacacccgaggagcgggaggagtggacg
actgccatccagacagtggccgacgggctcaagaggcaggaggaagagatgatggacttc
cggtcgggctcgcccagtgacaactcgggggctgaggagatggaggtgtccctggccaag
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaagctgctggggaagggcaca
tttgggaaggtgatcctggtcaaggagaaggccacgggccgctactacgccatgaagatc
ctgaagaaggaggtcattgtggccaaggacgaggttgcccacacgctcacggagaaccgt
gttctccagaactctcggcaccccttcctgacggccctgaagtactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacggcggcgaggtagggtggccgcggcgg
gcgtggcgctggccccgagccctggggtccccgcccgggaggcagggtctcggcccgcag
cccgcacaccctcacgccctcgtcccgcagctcttcttccacctgtcccgggagcgggtg
ttccccgaggaccgggcgcgcttctacggcgccgagatcgtgtcggccctggactacctg
cactcggagaagaacgtggtctaccgcgacctcaagctggagaacctcatgctggacaag
gacgggcacatcaagatcacggacttcgggctgtgcaaggaaggcatcaaggacggagcc
accatgaagaccttctgcgggacgcccgagtacctggcccccgaggtgctggaggacaac
gactacggccgggcggtggactggtgggggctgggcgtggtcatgtacgagatgctgtgc
ggccgcctgcccttctacaaccaggaccacgagaagctcttcgagctcatcctcatggag
gagctgcgcttcccgcgcacgctcagccccgaggccaagtccctgctctcagggctgctc
aaaaaggaccccaagcagaggctcggagggggctcagaggacgccaaggagatcatgcag
caccgcttcttcgctagcatcgtgtggcaggacgtgtacgagaagaagctcagtccgccc
ttcaagcctcaggtcacgtcggagacggacaccaggtattttgatgaggagttcacggcc
cagatgatcaccatcacgccgcccgaccaaggtgacaacatggagggcgaggacagcgag
cggaggccccacttcccgcagttctcctactcggccagcggcacggcgtga

DBGET integrated database retrieval system