KEGG   Vulpes vulpes (red fox): 112923938
Entry
112923938         CDS       T05911                                 

Gene name
AIFM2
Definition
(RefSeq) apoptosis-inducing factor 2
  KO
K22745  apoptosis-inducing factor 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112923938 (AIFM2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO K_oxygenase GIDA Thi4 Lycopene_cycl Trp_halogenase NAD_binding_8 HI0933_like AlaDh_PNT_C FAD_binding_2 FAD_binding_3 NAD_binding_7 DUF4147 FAD_oxidored StbA
Other DBs
NCBI-GeneID: 112923938
NCBI-ProteinID: XP_025859650
UniProt: A0A3Q7SSD6
LinkDB
Position
Unknown
AA seq 373 aa
MGSQVSVDMGAVRVVIVGGGFGGIAAASQLQTLNIPFMLVDMKDSFHHNVAALRASVESG
FAKKTFISYSVTFKENFRQGLVVEIDVQNQMVLLEDGEALPFSHLILATGSTGLFPGKFN
QVSSRELAIQAYEDMVKQVQRSQSVVVVGGGSAGVEMAAEVKTEFPEKEVTLIHSQVALA
DKELLPCVRQEAKEILLQKGVQLLLSERVSNLEDLPLNEYRERIQVHTDKGTEVATNLVI
VCNGIKVNSSAYHSAFDDHLASNGALRVNEYLQVEGYSHIYAIGDCADVKEPKMAYHAGL
HASVAVANIVNSRKQRPLKAYKPGALTFLLAMGRNDGVGQISGFYVGRLMVRLAKSRDLF
VSSSWKTMRQSPP
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggggtcccaggtctctgtggacatgggagccgtgcgcgtggtgatcgtgggtggcggc
ttcggtgggatcgctgctgccagccagctgcagactctgaacatccccttcatgctggtg
gacatgaaggactcctttcaccacaacgtggcagccctccgggcctccgtggaaagtggc
tttgcaaaaaagacattcatttcctactcggtgacctttaaggagaacttccggcagggg
ctagtcgtagagatcgacgtgcagaatcagatggtgctgctggaggatggtgaggccctg
cccttctcccatcttatcctggccaccggcagcaccgggctcttcccgggcaaatttaac
caggtttccagccgggagctggctatccaggcctatgaggacatggtgaagcaggtccag
cgctcacagtcggtggtggtggtgggaggcggctctgccggcgtggagatggcagcggag
gttaagaccgaattccccgagaaagaggtcactctcatccactcccaagtggcccttgct
gacaaggagctcctgccctgtgtccggcaggaagcgaaggagatcctgctccagaaaggc
gtgcagctgctgctgagtgagcgggtgagcaacctggaggacctgcctcttaacgagtat
cgagagcgcatccaagtgcacacggacaaaggcacggaggtggccaccaacttggtgatc
gtctgcaacggcattaaagtcaacagctctgcctaccacagtgcatttgatgatcacctg
gccagcaatggcgctctgagagtgaacgagtacctccaggtggagggctacagtcacatc
tacgccattggcgactgtgcggacgtgaaggaacccaaaatggcctatcatgccggcctc
catgccagcgtcgccgtggccaacattgtcaactccaggaagcagaggcccctcaaggcc
tataagccaggtgcgctgacgttcctcctggccatggggagaaatgacggcgtgggccag
atcagtggcttctatgtggggcggctcatggtgcggctggccaagagccgggacctgttc
gtctcctccagctggaagaccatgcgacagtctccaccttga

DBGET integrated database retrieval system