KEGG   Vulpes vulpes (red fox): 112924073
Entry
112924073         CDS       T05911                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03420  Nucleotide excision repair
vvp04115  p53 signaling pathway
vvp04120  Ubiquitin mediated proteolysis
vvp05161  Hepatitis B
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112924073 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    112924073 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112924073 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924073 (DDB2)
   05202 Transcriptional misregulation in cancer
    112924073 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112924073 (DDB2)
   05212 Pancreatic cancer
    112924073 (DDB2)
   05225 Hepatocellular carcinoma
    112924073 (DDB2)
   05226 Gastric cancer
    112924073 (DDB2)
   05214 Glioma
    112924073 (DDB2)
   05216 Thyroid cancer
    112924073 (DDB2)
   05220 Chronic myeloid leukemia
    112924073 (DDB2)
   05217 Basal cell carcinoma
    112924073 (DDB2)
   05218 Melanoma
    112924073 (DDB2)
   05213 Endometrial cancer
    112924073 (DDB2)
   05224 Breast cancer
    112924073 (DDB2)
   05222 Small cell lung cancer
    112924073 (DDB2)
   05223 Non-small cell lung cancer
    112924073 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112924073 (DDB2)
   05169 Epstein-Barr virus infection
    112924073 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:vvp04121]
    112924073 (DDB2)
   03400 DNA repair and recombination proteins [BR:vvp03400]
    112924073 (DDB2)
Ubiquitin system [BR:vvp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     112924073 (DDB2)
DNA repair and recombination proteins [BR:vvp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      112924073 (DDB2)
SSDB
Motif
Pfam: WD40 EF-hand_1
Other DBs
NCBI-GeneID: 112924073
NCBI-ProteinID: XP_025859826
UniProt: A0A3Q7SVH8
LinkDB
Position
Unknown
AA seq 456 aa
MAPRKRPETQKTPEVAVRPKSKRSRSPRELEPEAKKLCVKGPGSSRRFDSGCLWAGLASL
QVPPSCSSIVRALHHHKLGKAAWPSLQQGLQQSFLHSLASYRIFQKAAPFDRRATSLAWH
PTHPSTLAVGSKGGDIMLWNFGMKDKPTFIKGIGAGGSITGLKFNPLDTNQFFTSSMEGT
TRLQDFKGNTLRVFTSSGTCNFWFCSLDVSARSRMVVTGDNVGHVILLNMDGREVRSLEP
SSPLSVPCTWPPCAPPELSPSLQLWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWD
LRQVRGKSSFLHSLPHSHPVNAACFSPDGAQLLTTDQKSELRVYSASQWDYPPSLIPHPH
RHFQHLTPIKATWHPRYNLIVVGRYPDPNFKSCTPHELRTIDVFDGSSGKMMYQLYDPES
SGIISLNEFNPMGDTLASVMGYHILIWSQEEARMRP
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacgcccagaaacccagaagaccccagaggtggctgtgcgccccaag
agcaagaggagcagaagcccccgggagctggagcccgaggccaagaagctctgtgtgaag
ggccccggttctagcagaagatttgactcaggctgcctttgggcggggttggctagcctg
caggtcccgccatcatgcagcagcatcgtcagggcgctccaccaccataagctgggcaaa
gctgcctggccgtcactgcagcagggtctccagcagtcctttttgcattctctggcttct
taccggatattccaaaaggctgccccttttgacaggagggccacatccttggcatggcat
ccaactcaccccagcaccctggctgtgggttccaaagggggagatatcatgctctggaac
tttggcatgaaggacaaacctaccttcattaaagggattggagctggagggagcatcact
gggctgaagtttaaccctcttgataccaaccagtttttcacctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacactctgcgagtttttaccagctcaggcacctgc
aacttctggttttgcagcctggatgtgtctgccagaagccgaatggtggtcacaggagac
aatgtggggcacgtgatcctactcaacatggatggcagggaggtgcgttctctggagccc
agttcccccctttctgtcccttgcacctggcctccctgcgccccacctgaactgagccct
tctctgcagctctggaatctgagaatgcacaaaaagaaagtgacccacgtggccctgaac
ccatgctgtgattggttcctggccacagcctccgtagatcaaacagtgaaaatctgggac
ctgcgccaggttagagggaaatccagcttccttcactcgctgccgcatagccatcctgtc
aatgcagcctgtttcagtcctgatggagcccagctcttgaccactgaccagaagagtgag
ctccgggtttactcagcctcccagtgggactatcccccaagcctgatcccacaccctcac
cgccacttccagcacctgacacccatcaaggcaacctggcatcctcggtacaacctcatt
gtcgtgggccgatacccagatcccaatttcaaaagctgtacccctcacgaattaaggacg
attgatgtgtttgacggaagctcagggaagatgatgtatcagctctatgacccagaatct
tctggtatcatttcgctcaatgagttcaatcctatgggggacacgctggcctctgtgatg
ggttatcacattctcatttggagccaggaggaagccaggatgcggccatga

DBGET integrated database retrieval system