KEGG   Vulpes vulpes (red fox): 112924116
Entry
112924116         CDS       T05911                                 

Gene name
CD82
Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112924116 (CD82)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112924116 (CD82)
  Exosomal proteins of other body fluids (saliva and urine)
   112924116 (CD82)
  Exosomal proteins of colorectal cancer cells
   112924116 (CD82)
CD molecules [BR:vvp04090]
 Proteins
  112924116 (CD82)
SSDB
Motif
Pfam: Tetraspanin DUF2157 DUF1310 Adeno_E3_CR2
Other DBs
NCBI-GeneID: 112924116
NCBI-ProteinID: XP_025859922
UniProt: A0A3Q7TF00
LinkDB
Position
Unknown
AA seq 268 aa
MGSACIKVTKYFLFLFNLLFFILGAVILGFGVWILADRSSFISVLQTSSNSLKVGACVFI
GVGAVTMFMGFLGCIGAIKEVRCLLGLYFAFLLFMLIVQVAAGVLFYFNTGKLKQEMGSI
VMKLIQDYKDGQEDRLQEAWDYVQAQVRCCGWASFYNWTDNAELMNRTNITYPCSCEDKR
EADDSFLVRKGFCEAFNSTRTESGNNPEYWPVYREGCMKKVQAWLQENVGIILGVCVGVA
VIELLGMLLSICLCRHVHSEDYSKVPKY
NT seq 807 nt   +upstreamnt  +downstreamnt
atggggtcagcctgtatcaaagtcaccaagtactttctcttcctcttcaacttgctcttc
tttatcctgggcgcggtgatcctgggtttcggggtgtggatcctggctgacaggagcagt
ttcatctctgtgctacagacctcctccaactccctcaaggtgggggcctgtgtcttcatc
ggcgtgggtgccgtcaccatgttcatgggcttcctgggctgcatcggtgccatcaaggag
gtccgctgcctgctggggctgtactttgccttcctcctcttcatgctcatcgtccaggtg
gccgctggagtcctcttctacttcaacacaggcaagctaaagcaagagatgggcagcatc
gtgatgaagctcatccaggactacaaggacggccaagaggacagactgcaggaggcctgg
gactacgtgcaggctcaggtgaggtgctgcggctgggccagcttctacaactggacggac
aatgccgagctcatgaaccgcaccaatatcacctacccctgctcctgcgaggataagagg
gaggccgacgacagcttcctggtgcggaagggcttctgtgaggctttcaacagcaccagg
accgagagtggaaacaaccctgagtactggcccgtgtaccgtgagggctgcatgaagaag
gtgcaggcgtggcttcaggagaatgtgggcatcatcctgggcgtgtgtgtgggcgtcgct
gtcattgagctcctggggatgctcctgtccatctgcttgtgccggcacgtccattctgaa
gactacagcaaggtccccaagtactga

DBGET integrated database retrieval system