KEGG   Vulpes vulpes (red fox): 112924121
Entry
112924121         CDS       T05911                                 

Gene name
PIDD1
Definition
(RefSeq) p53-induced death domain-containing protein 1 isoform X1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04064  NF-kappa B signaling pathway
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112924121 (PIDD1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112924121 (PIDD1)
   04115 p53 signaling pathway
    112924121 (PIDD1)
SSDB
Motif
Pfam: LRR_8 Peptidase_S68 LRR_4 Death ZU5
Other DBs
NCBI-GeneID: 112924121
NCBI-ProteinID: XP_025859931
UniProt: A0A3Q7SVS9
LinkDB
Position
Unknown
AA seq 939 aa
MAAEAEGLEPQAAATEDAAGDATEAADAELCLLVGNRLSLDLYPGGCHRLLHLCAQQPPQ
LREVEFLQLSGHEDPQLLEATLTQVPRSLQRLRSLVLRGGQHWDVLGACLRGSLTTLPAG
LSGLARLAHLDLSFNSLETLPACIPRMRGLSTLLLSYNHLSELPEALGALPSLTFLSVTH
NHLQTLPIALGALSTLQRLDLSGNLLDTLPPEIGALSSLTELNLASNRLQSLPTSLVGLQ
SLRLLVLHSNLLTSVPTGLVHLPLLTRLDLRDNQLRDVPPELLDAPFVRLQGNPLGEALP
ASRSPPGAPVILEMPRLFLNSDVDSFPVTPQGCSVTLACGVRLQFPAGATVSPVNIQYRL
WLPEPRLVPLGPHDSLLSGVLELQPHGVAFRQKVSLWLLFMPPRIRRCREVVVRTLSGDS
WGDLDTHVEEEAPKRLWAHCQVPHFSWFLVVSRPVSNTCLVPPEGTLLCCSGYPGVKVTF
PPGATEEPRSVCMQVRTGQPLWMVGGFSTHRQAWGPCLPQVVRMASRELRALLGEPEAAA
SPLLCLSQSGGPPGFLQPVTVQLPLPPGVTGLSLDRSCLHLLYRTPLEAAWDDITAQVAL
ELTHLYARFQVTHFSWYWLWYTTKTCVQDLARKAWERLRLHRVNLIALQRRRDPEQVLLQ
CLPRDKVDATLRRLLDRYRGPEPSDTVEMFEGEKFFAAFEKGIDVDAERPDCVEGRVCFV
FYSHLKNVKEVYVTTTLDRQVQAVRGQVSFYRGAVPEEVPEEAKAARQRKGMDTVWMATL
PIKLPRLRGSEGLGQGRGPSLSLAPLNLGDAETGFLTQSNLLTVAGRLGPDWPAVALHLG
LPYRELQRIRHEFRDDLDGQIRHMLFSWAERQAGQPGAVGLLLRALEQSDRLDIAEEVRA
ILELGRQKYKDSIQRTSLAPRGLDPADPAAPQSVESAQV
NT seq 2820 nt   +upstreamnt  +downstreamnt
atggctgcagaggcagaggggctggagccccaggcagctgctacagaagatgctgcagga
gatgccacagaggctgcggatgcggagctctgtctcctggttgggaaccggttgagcctg
gacctgtaccctggggggtgccaccggctgctccatctctgtgcccagcaaccccctcag
ctgcgggaagtggagttcttgcagctgagtggccacgaggaccctcagctgctagaggct
accctgacccaggtgccgcggagcctgcagcgccttcgctccctggtcctcagaggtgga
caacactgggatgtgctgggtgcctgcctccggggctctctgaccacactgcccgctggc
ctgagtggcctggcccgcttggcccacctagatctgagcttcaacagcctggagacgctg
ccggcctgcatcccacgaatgcgtggcctgagcaccctcctgctctcttacaaccacctc
tcagagctccctgaggccctcggagccctcccctcccttaccttcctctctgtgacccat
aatcatttgcaaacgctgcccatagcgctgggagctctctccaccctgcagcgccttgat
ctctcagggaaccttctggacactctgccccctgagattggagccctgagcagcctcact
gagctcaatctggcttccaaccggctgcagagcctcccgacctcccttgtggggctgcag
tccttgcggctccttgttttgcacagcaacctcctgacctcagtgcccaccggcctggta
cacctcccgctgctcactcggctggatctgagggacaaccagctccgggacgtgcccccg
gagctcctggacgccccctttgtgcgccttcaggggaaccccctgggcgaggctctacct
gcctcccgaagccccccaggggcaccggtgatcctggaaatgcccagactgttcctgaat
tcagatgtggacagcttccctgtgactccccaaggctgctccgtgaccctggcctgtggc
gtccgcctgcagttccctgctggggctactgttagccctgtcaacatccagtatcgtctc
tggctgccagagccacgccttgttcccttgggtccccatgactccctgctcagtggtgtc
ctggagctgcagccccatggggtggccttccggcagaaggtgagcctgtggctgctcttc
atgcccccccgcatccggcgttgccgggaggtggtggtcaggaccctgagtggtgatagc
tggggtgacctggacactcatgtggaagaagaggcacccaagcggctttgggctcactgc
caggtgccccacttctcatggttcctcgtggtttcgcgtcctgtgtccaacacctgcctg
gtgccaccagaggggacgttgctgtgctgctcaggatatcccggggtcaaggtcacattc
ccacctggggccaccgaagagcctcgtagtgtctgcatgcaggtgcggacagggcagcct
ctgtggatggtgggtggtttctcaacgcataggcaagcctggggtccctgtttgccccag
gtggtgcgcatggccagcagagaacttcgagccctgctgggggagcctgaggctgcggcc
agccccctgctgtgcctctcacagagtggtggccctcctggcttcctccagcctgtcact
gtgcagctgcctttgccccctggggttacaggcctgagtctggatcgctcttgtcttcac
ctgctgtaccggacccctcttgaagctgcttgggatgacatcacagctcaggtggccctg
gagctcacccacctgtatgctcgcttccaggtcacccacttctcttggtactggctctgg
tacaccaccaagacctgtgtgcaagacctggctcggaaggcctgggagcggctgcgtctg
caccgagtcaacctcattgccctgcagaggcgccgggacccagagcaggtcctgctgcaa
tgcctgccccgcgacaaggtggatgccaccctgcggcgactgctggaccgttaccgaggc
cctgagccctctgacacggtggagatgtttgagggtgaaaaattcttcgctgcttttgag
aagggtattgatgtggatgctgaacgcccagactgcgtggaaggcagggtctgctttgtc
ttctactcacacttgaagaatgtgaaggaggtctacgtgaccactaccctggaccggcag
gttcaggctgtgaggggccaggtgtccttctaccggggagcagtgcctgaggaggtgcct
gaggaggccaaggctgcccggcagaggaagggcatggacaccgtgtggatggccactcta
cccatcaagctgccgagattgcgggggtctgaggggctggggcaggggcgggggcctagc
ctctccctggcacctctgaacctgggcgatgctgagactggcttcctgacccagagcaac
ctgctgaccgtggctggacgcctgggccctgactggccggctgtggccctgcacctgggc
ctgccctaccgggagctgcagcgcatccgtcatgagttccgggatgacctggatggccag
atccgtcatatgctcttctcctgggctgagcgccaggctgggcaaccaggggctgtgggg
cttctcctgcgggccttggagcagagtgaccggctggatatagctgaggaggtgagggcc
atcctggagcttggccgccagaagtacaaggacagcatccagcgcacaagcctggccccc
aggggccttgacccagctgaccctgcagcaccacagtctgtggagtctgcccaggtgtag

DBGET integrated database retrieval system