KEGG   Vulpes vulpes (red fox): 112924145
Entry
112924145         CDS       T05911                                 

Gene name
DDIT4
Definition
(RefSeq) DNA damage-inducible transcript 4 protein
  KO
K08270  DNA-damage-inducible transcript 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112924145 (DDIT4)
   04150 mTOR signaling pathway
    112924145 (DDIT4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112924145 (DDIT4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112924145 (DDIT4)
SSDB
Motif
Pfam: RTP801_C
Other DBs
NCBI-GeneID: 112924145
NCBI-ProteinID: XP_025859978
UniProt: A0A3Q7ST54
LinkDB
Position
Unknown
AA seq 230 aa
MPSLWDRFSSSSSSSSSLPRTPTPDQPPRSAWGSAAREEGLGRCASLESSDCESLDSSNS
GFGPEEDSAYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLSQARLGSRRPARLLMPGQ
LVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHNVGQLALDPSLVPTFQLTLVLRLD
SRLWPKIQGLFSSANSSFVPGFSQSLTLSTGFRVIKKKLYSSEQLLIEEC
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcctagcctttgggatcgcttctcgtcgtcgtcctcctcctcgtcgtccttgccccga
acccccacccccgatcagccgccgcgctcagcctgggggtcggcggcccgggaagagggg
cttggccgctgcgcgagcctggagagctcggactgcgagtccctggacagcagcaacagt
ggcttcgggccggaggaagactcggcgtacctggatggggtgtccctgcccgacttcgag
ctgctcagcgaccccgaggatgagcacttgtgtgccaacctgatgcagctgctgcaggag
agcctgtcccaggcgcggctgggctcgcggcgccctgcgcgcctgctgatgcccggccag
ctggtgagccaggtgggcaaggagctgctgcgcctggcctacagcgagccgtgcggcctg
cggggggcgctgctggacgtctgcgtagagcaaggcaagagctgccacaacgtcggccaa
ctggccctcgaccccagcctggtgcccaccttccagctgaccctcgtgctgcgcctggac
tcccgcctctggcccaagatccaggggctgttcagctccgccaactcgtcgttcgtcccc
ggcttcagccagtccctgacgctgagcacgggcttccgagtcatcaagaagaagctgtac
agctcggagcagctgctcatcgaggagtgttga

DBGET integrated database retrieval system