KEGG   Vulpes vulpes (red fox): 112924254
Entry
112924254         CDS       T05911                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01523  Antifolate resistance
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04064  NF-kappa B signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04137  Mitophagy - animal
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04218  Cellular senescence
vvp04380  Osteoclast differentiation
vvp04620  Toll-like receptor signaling pathway
vvp04621  NOD-like receptor signaling pathway
vvp04622  RIG-I-like receptor signaling pathway
vvp04623  Cytosolic DNA-sensing pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04657  IL-17 signaling pathway
vvp04658  Th1 and Th2 cell differentiation
vvp04659  Th17 cell differentiation
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04668  TNF signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp04917  Prolactin signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04926  Relaxin signaling pathway
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05030  Cocaine addiction
vvp05132  Salmonella infection
vvp05133  Pertussis
vvp05134  Legionellosis
vvp05135  Yersinia infection
vvp05140  Leishmaniasis
vvp05142  Chagas disease
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05203  Viral carcinogenesis
vvp05212  Pancreatic cancer
vvp05215  Prostate cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05321  Inflammatory bowel disease
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112924254 (RELA)
   04014 Ras signaling pathway
    112924254 (RELA)
   04064 NF-kappa B signaling pathway
    112924254 (RELA)
   04668 TNF signaling pathway
    112924254 (RELA)
   04066 HIF-1 signaling pathway
    112924254 (RELA)
   04071 Sphingolipid signaling pathway
    112924254 (RELA)
   04024 cAMP signaling pathway
    112924254 (RELA)
   04151 PI3K-Akt signaling pathway
    112924254 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112924254 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    112924254 (RELA)
   04218 Cellular senescence
    112924254 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112924254 (RELA)
   04621 NOD-like receptor signaling pathway
    112924254 (RELA)
   04622 RIG-I-like receptor signaling pathway
    112924254 (RELA)
   04623 Cytosolic DNA-sensing pathway
    112924254 (RELA)
   04625 C-type lectin receptor signaling pathway
    112924254 (RELA)
   04660 T cell receptor signaling pathway
    112924254 (RELA)
   04658 Th1 and Th2 cell differentiation
    112924254 (RELA)
   04659 Th17 cell differentiation
    112924254 (RELA)
   04657 IL-17 signaling pathway
    112924254 (RELA)
   04662 B cell receptor signaling pathway
    112924254 (RELA)
   04062 Chemokine signaling pathway
    112924254 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112924254 (RELA)
   04917 Prolactin signaling pathway
    112924254 (RELA)
   04926 Relaxin signaling pathway
    112924254 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112924254 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112924254 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    112924254 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924254 (RELA)
   05202 Transcriptional misregulation in cancer
    112924254 (RELA)
   05203 Viral carcinogenesis
    112924254 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112924254 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112924254 (RELA)
   05221 Acute myeloid leukemia
    112924254 (RELA)
   05220 Chronic myeloid leukemia
    112924254 (RELA)
   05215 Prostate cancer
    112924254 (RELA)
   05222 Small cell lung cancer
    112924254 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    112924254 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112924254 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    112924254 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112924254 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112924254 (RELA)
   04931 Insulin resistance
    112924254 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112924254 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112924254 (RELA)
   05135 Yersinia infection
    112924254 (RELA)
   05133 Pertussis
    112924254 (RELA)
   05134 Legionellosis
    112924254 (RELA)
   05152 Tuberculosis
    112924254 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112924254 (RELA)
   05170 Human immunodeficiency virus 1 infection
    112924254 (RELA)
   05162 Measles
    112924254 (RELA)
   05164 Influenza A
    112924254 (RELA)
   05161 Hepatitis B
    112924254 (RELA)
   05160 Hepatitis C
    112924254 (RELA)
   05168 Herpes simplex virus 1 infection
    112924254 (RELA)
   05163 Human cytomegalovirus infection
    112924254 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112924254 (RELA)
   05169 Epstein-Barr virus infection
    112924254 (RELA)
   05165 Human papillomavirus infection
    112924254 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112924254 (RELA)
   05145 Toxoplasmosis
    112924254 (RELA)
   05140 Leishmaniasis
    112924254 (RELA)
   05142 Chagas disease
    112924254 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    112924254 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112924254 (RELA)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    112924254 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 112924254
NCBI-ProteinID: XP_025860213
UniProt: A0A3Q7STR1
LinkDB
Position
Unknown
AA seq 549 aa
MDDLFPLIFPAAGRCLATEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTD
TTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSF
QNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPL
RLSPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGW
EARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTD
DRHRIEEKRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTTSVPKPAPQSYPFTP
SLSTINFEEFSPMVFSSGQISSQTSALASAPAPAPILAPAPPAPAPAPILAPGLAQAMAP
PAPKTTQAGEGTLTEALLQLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQLLNQGV
SVAPHTAEPMLMEYPEAITRLVTGSQRPPDPVPAPVGASGLPNGLLSGDEDFSSIADMDF
SALLSQISS
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggacgacctgtttcccctcatcttcccagctgctggtcggtgtctggccacagagccc
gcccaggcctctggcccctatgtggagatcatcgagcaacccaagcagcggggcatgcgc
ttccgctacaagtgcgagggccgctcagcgggcagcatcccgggcgagaggagcacagac
accaccaagacccaccccaccatcaagatcaatggctacacggggccagggacagttcgc
atctccctggtcaccaaggacccccctcaccggcctcatccccatgagcttgtggggaaa
gactgccgggatggcttctatgaggctgagctctgccccgaccgctgcatccacagcttc
cagaacctggggatccagtgtgtaaagaagcgggacctggagcaggccatcagccagcgc
atccagaccaacaacaaccccttccaagttcccatagaagaacagcgtggggactatgac
ctgaatgcggtgcggctctgcttccaggtgacagtgcgggacccggcaggcaggcccctg
cgcttgtcacctgtcctctcccatcccatctttgacaaccgtgcccccaacactgctgag
ctcaagatctgccgagtgaaccgaaactctgggagctgcctcgggggggatgagatcttc
ctgctctgtgacaaggtgcagaaagaggacattgaagtgtatttcacgggaccaggctgg
gaggcccgaggctccttttctcaagctgatgtacaccgacaagtagccattgtattccgg
acacctccctacgcggaccccagcctgcaggctcccgtgcgtgtctccatgcagctgcgg
cggccttctgatcgggagctcagtgagcccatggaattccagtacttgccagacacagat
gatcgtcaccggattgaagagaaacgtaaaaggacatatgagaccttcaagagcatcatg
aaaaagagtcctttcaatggacccactgacccccggcctccaccccggcgcattgctgtg
ccttcccgaagcacgacttccgtccccaagccagctccccagtcctatccctttacgcca
tccctcagcaccatcaacttcgaggagttctcccccatggtcttttcttcggggcagatc
tcaagccagacctctgccttggcatcagcccctgcccctgccccaatcctggccccggcc
ccgccagccccagcccctgccccaatcttagccccaggccttgctcaggccatggccccc
cctgcccccaagaccacccaagccggggaagggacgctgacagaggccctgctacagctg
cagtttgatgctgatgaagacctgggggccctgctgggcaacagcgctgacccagcggtg
ttcacagacctggcctccgttgacaactctgagtttcagcagctgctgaaccagggtgta
tctgtggccccccacacagctgagcccatgctgatggagtaccctgaggcaataacgcgc
ctggtgacagggtcccagaggccccctgacccagttcctgctcccgtaggggcctctggg
ctccccaacggcctcctctcaggggatgaagacttctcctccattgcagacatggacttc
tcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system