KEGG   Vulpes vulpes (red fox): 112924315
Entry
112924315         CDS       T05911                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04140  Autophagy - animal
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04370  VEGF signaling pathway
vvp04510  Focal adhesion
vvp04722  Neurotrophin signaling pathway
vvp04910  Insulin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp05010  Alzheimer disease
vvp05014  Amyotrophic lateral sclerosis
vvp05020  Prion disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05165  Human papillomavirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112924315 (BAD)
   04014 Ras signaling pathway
    112924315 (BAD)
   04370 VEGF signaling pathway
    112924315 (BAD)
   04024 cAMP signaling pathway
    112924315 (BAD)
   04022 cGMP-PKG signaling pathway
    112924315 (BAD)
   04151 PI3K-Akt signaling pathway
    112924315 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112924315 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    112924315 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112924315 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    112924315 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112924315 (BAD)
   04919 Thyroid hormone signaling pathway
    112924315 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112924315 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924315 (BAD)
   05203 Viral carcinogenesis
    112924315 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112924315 (BAD)
   05212 Pancreatic cancer
    112924315 (BAD)
   05225 Hepatocellular carcinoma
    112924315 (BAD)
   05221 Acute myeloid leukemia
    112924315 (BAD)
   05220 Chronic myeloid leukemia
    112924315 (BAD)
   05218 Melanoma
    112924315 (BAD)
   05211 Renal cell carcinoma
    112924315 (BAD)
   05215 Prostate cancer
    112924315 (BAD)
   05213 Endometrial cancer
    112924315 (BAD)
   05223 Non-small cell lung cancer
    112924315 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112924315 (BAD)
   05014 Amyotrophic lateral sclerosis
    112924315 (BAD)
   05020 Prion disease
    112924315 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    112924315 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112924315 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112924315 (BAD)
   05161 Hepatitis B
    112924315 (BAD)
   05160 Hepatitis C
    112924315 (BAD)
   05162 Measles
    112924315 (BAD)
   05168 Herpes simplex virus 1 infection
    112924315 (BAD)
   05165 Human papillomavirus infection
    112924315 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112924315 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112924315 (BAD)
   01524 Platinum drug resistance
    112924315 (BAD)
   01522 Endocrine resistance
    112924315 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 112924315
NCBI-ProteinID: XP_025860350
UniProt: A0A3Q7SWS0
LinkDB
Position
Unknown
AA seq 157 aa
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPGLLGEAGHQQGQPASRKHHGGAGAETRS
RHSSFPAGTDEDEGMEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSFKGLPR
PKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
NT seq 474 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcccagtgagcaggaagactccagccctgcaaatagg
ggcttgggccccagccccacaggggaccggcccccaggcctcctaggggaagctggtcac
cagcaggggcagccagccagccgcaaacaccatggaggcgctggggctgagacccggagt
cgccacagctcgttccccgcggggaccgacgaggatgaaggaatggaggaagaagagctc
agccctttccgggggcgctcgagctcagcgccccccaacctctgcgcagcactgcgctat
ggccgcgagctccgcaggatgagcgacgagttccagggctccttcaagggacttcctcgc
ccgaagagcgcggggacagcgacgcagatgcgacaaagccccagctggacgcgcgtcatc
cagtcctggtgggatcggaacttggggagaggaggctccgccccgtcccagtga

DBGET integrated database retrieval system