KEGG   Vulpes vulpes (red fox): 112924654
Entry
112924654         CDS       T05911                                 

Definition
(RefSeq) cadherin-1-like
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04015  Rap1 signaling pathway
vvp04371  Apelin signaling pathway
vvp04390  Hippo signaling pathway
vvp04514  Cell adhesion molecules
vvp04520  Adherens junction
vvp05100  Bacterial invasion of epithelial cells
vvp05200  Pathways in cancer
vvp05213  Endometrial cancer
vvp05216  Thyroid cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112924654
   04390 Hippo signaling pathway
    112924654
   04371 Apelin signaling pathway
    112924654
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112924654
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112924654
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924654
  09162 Cancer: specific types
   05226 Gastric cancer
    112924654
   05216 Thyroid cancer
    112924654
   05218 Melanoma
    112924654
   05219 Bladder cancer
    112924654
   05213 Endometrial cancer
    112924654
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    112924654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvp03036]
    112924654
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:vvp04515]
    112924654
   04090 CD molecules [BR:vvp04090]
    112924654
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112924654
Cell adhesion molecules [BR:vvp04515]
 Cadherins
  Major cadherins
   112924654
CD molecules [BR:vvp04090]
 Proteins
  112924654
SSDB
Motif
Pfam: Cadherin Transthyretin Big_9
Other DBs
NCBI-GeneID: 112924654
NCBI-ProteinID: XP_025860819
UniProt: A0A3Q7SHW0
LinkDB
Position
Unknown
AA seq 646 aa
MAGPTCFLLFLSATQLFAQRMPFSEGAPKTPQKLGLGVKDLHGNETLQQGAHAGYQMEVL
TFPHARFGLKRQKRDWVVPPISIPENERGPFPKMVAQVKSNKNKEIQVFYSITGTGADEP
PYGVFIMDRETGWLKVTKPLDREKKSHYVLFLHAVSSTGNAVEDTLEIVITVTDQNDNRP
EFTQEVFEGSVMERAHPGTSVLQITATDVDDHENTYNAAIVYTILSQDPLVPHSNMFAIN
RQTGVISVLNPGLDQQSAPAYTLTVQAADLQGEGLSCRAKAVITVTQSNPNPPVFSPTSY
TGQVFENKVDAGIVRLYVKDADAAGSPAWKAVFSILNDRGGLFTITTDPETNDGLLKTAK
GLDFETTQQYTLYVTVVNEVPLASLSTSTATVTVDVVDVNEAPVFVPPTKIVEMPKDVGV
GQEITSYKAQDPDSFQSQKIRYQIWDDPSHRLDINSETGVISTRASLQMEDMKTQTFSAV
VIATDNGQPPATGTGTLLLTFSHIDCPGVDSHCLDICQRGPESQAGGGMEQISSPLTTHV
LDTASGLPAQGLCLRLSRLEDHGQQWTELKKSYTDSDGRCPGLMPPGPMKAGTYKLSFDT
EGYWKKRGQESFYPYVEVVFTIANETHRFHVPLLLSPWSYTTYRGS
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggctggtcccacctgctttctgctcttcttgtctgccacccagctttttgcccagagg
atgcctttcagtgagggggctcccaagacacctcaaaaactggggttgggggtgaaagat
ctgcatggtaacgagaccctccagcagggtgctcacgctggataccagatggaggtgcta
accttccctcatgcccgcttcggtctcaagaggcaaaagagagactgggttgtccctccc
atctccatcccagagaatgaaagagggccattcccaaagatggtggctcaggtcaaatct
aacaagaacaaggaaatccaggttttctacagcatcactggcacaggtgctgatgaacct
ccttatggcgtgtttatcatggacagagaaacaggatggctgaaggtgacgaagcccctg
gacagagaaaaaaaatcccactatgttcttttccttcatgctgtgtcttcaactggaaat
gctgtggaggatacgttggagattgtgatcacagtgacagaccagaatgacaacagaccc
gaattcacccaggaggtctttgaggggtctgtgatggaaagagcccatccaggaacatcc
gtgctacaaatcaccgcaacagatgtggatgaccatgagaacacctacaatgcagccatt
gtttacaccatcctcagccaagatcccttggtacctcactccaacatgttcgccatcaac
cggcaaacaggagtcatctctgtgctcaatcctgggctggaccaacagagtgctcctgca
tacaccctgacagtccaagctgctgacctccaaggtgaaggcttaagctgtagagcaaag
gccgtgatcacagtcacccagagcaaccctaaccctcccgtcttcagccccacttcgtac
acgggccaggtgtttgagaacaaggtggatgcagggatagtgaggctgtacgtgaaagat
gctgatgctgctggctccccagcatggaaggcagtgttctccatcctcaatgacagaggt
ggcctctttactatcaccacggaccctgagaccaatgacggccttttgaaaacagccaag
ggcttggattttgagaccacgcagcaatacaccctttatgtgacagtggtgaatgaggtg
cccttggcatctctttccacatccacagccacagtcactgtggacgtggttgacgtgaat
gaggctcctgtctttgtacccccgacaaagattgtggaaatgcccaaggatgttggtgtg
ggccaggaaatcacatcgtacaaggcccaggatccagacagctttcagtctcagaaaatc
aggtaccagatatgggacgacccaagccatcggttggacatcaactcagaaacaggtgtc
atttccactcgagccagtctgcaaatggaggacatgaaaacccaaacattttcagctgtt
gtcatagctacagacaatggccagcctcctgccacgggcaccgggaccctgctcctcact
ttctctcacatagactgcccaggagtagactcacactgccttgacatctgccagagggga
ccagagtctcaggctggcggaggcatggagcagatcagcagcccactgaccacacatgtg
ctggacactgcctcagggcttccggctcagggcctctgcctccgtctgtccaggctcgag
gaccatggccagcagtggacagagctgaagaaaagctacacggactcagatggccgctgc
ccagggctcatgcctccaggcccgatgaaggcaggcacctacaagctgtcctttgacacc
gagggctactggaagaagagagggcaggagagcttctacccatatgtggaggttgttttt
accatcgccaacgagacacacaggttccacgtgcctctgctgctgagcccatggtcctac
accacgtatcgagggagctag

KEGG   Vulpes vulpes (red fox): 112929524
Entry
112929524         CDS       T05911                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04015  Rap1 signaling pathway
vvp04371  Apelin signaling pathway
vvp04390  Hippo signaling pathway
vvp04514  Cell adhesion molecules
vvp04520  Adherens junction
vvp05100  Bacterial invasion of epithelial cells
vvp05200  Pathways in cancer
vvp05213  Endometrial cancer
vvp05216  Thyroid cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112929524 (CDH1)
   04390 Hippo signaling pathway
    112929524 (CDH1)
   04371 Apelin signaling pathway
    112929524 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112929524 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112929524 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112929524 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    112929524 (CDH1)
   05216 Thyroid cancer
    112929524 (CDH1)
   05218 Melanoma
    112929524 (CDH1)
   05219 Bladder cancer
    112929524 (CDH1)
   05213 Endometrial cancer
    112929524 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    112929524 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvp03036]
    112929524 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:vvp04515]
    112929524 (CDH1)
   04090 CD molecules [BR:vvp04090]
    112929524 (CDH1)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112929524 (CDH1)
Cell adhesion molecules [BR:vvp04515]
 Cadherins
  Major cadherins
   112929524 (CDH1)
CD molecules [BR:vvp04090]
 Proteins
  112929524 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 DUF4999 Big_9 Cadherin_4
Other DBs
NCBI-GeneID: 112929524
NCBI-ProteinID: XP_025867461
UniProt: A0A3Q7TQB8
LinkDB
Position
Unknown
AA seq 871 aa
MPPALLQVSSGLCQEPEPCRPGFGADSYTFTVPRRHLERGRVLGRVSFEGCTGLPRTAYV
SDDTRFKVGTDGVITVKRPLQLHKPEISFLVHAWDSSRRKLSTRVRLKAATHHHHHHDAP
SKTQTEVLTFPSSQHGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNRDKEIKVFYSI
TGQGADAPPVGVFIIERETGWLKVTEPLDREQIAKYILYSHAVSSNGNAVEDPMEIVITV
TDQNDNKPEFTQAVFQGSVTEGALPGTSVMQVTATDADDDVNTYNAAIAYSILTQDPLLP
SSMMFTINKDTGVISVLTTGLDREGVPMYTLVVQAADLQGEGLTTTATAVITVTDINDNP
PIFNPTTYQGRVPENKANVEIAVLKVTDADVPDTPAWKAVYTILNNNNDQFVVTTDPVTN
DGILKTTKGLDFEDKQQYVLYVTVVNVIPFEVILSTSTATVTVDVEDVNEAPIFIPSPKV
VSIPEDFGVGQEITSYTAEDPDTYMEQRITYRIWRDAAGWLEINPESGAIFTRAELDRED
FEHVKNSTYEALIIAIDNGSPVATGTGTLLLVLSDVNDNGPIPEPRNMDFCQKNPQPHVI
NIIDPDLPPNTSPFTAELTHGASVNWTIEYNDPARESLILKPKKTLELGDYKINLKLTDN
QNKDQVTTLDVFVCDCEGVVNSCKRTAPYAEAGLQVPAILGILGGILALLILILLLLLFV
RRRRVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTL
LSVPQYRPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSS
ESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgcctcctgccctcctccaggtctcatcggggctctgccaagagccggagccctgccgc
cctggctttggcgctgacagctacacgttcacggtgccccggcgacacttggagagaggc
cgtgtcctgggcagggtgagttttgaaggatgcaccggtctacccaggacagcctatgtt
tctgatgacacccgattcaaagtgggcacagatggtgtgattacagtcaagcggcctcta
caacttcataaaccagagataagttttcttgtccatgcctgggactccagccgcaggaag
ctctccaccagagttaggctgaaggcagcgacgcaccaccatcaccatcatgatgctccc
tctaaaacccagacagaggtgctcacatttcccagttcccagcatggactcagaagacag
aagagagactgggttatccctcctatcagctgcccggaaaacgagaaaggcccatttcct
aaaaacctggttcagatcaagtctaacagggacaaagaaatcaaggttttctacagcatc
actggccaaggagctgacgcacctcctgttggtgtgtttattattgaaagagaaacagga
tggctgaaggtgactgagcctctggatagagaacaaattgctaagtacattctctactca
catgctgtatcttctaatgggaatgcggtcgaagacccaatggagatcgtgatcacggtg
acagatcagaatgacaacaagcccgagttcacccaggcagtcttccaaggatctgtcacg
gaaggtgcccttccaggcacctctgtgatgcaggtgacagccacagatgcggatgatgac
gtgaacacctacaacgccgccatcgcttacagcatcctcacacaagaccccctcctgcct
agcagcatgatgttcactatcaacaaggacacaggagtcatcagcgtgctcaccactggg
ctggaccgagagggtgtccccatgtacaccttggtggttcaggctgctgacctgcaaggc
gaaggcttaactacaactgcaacagctgtgatcacagtcactgacatcaacgataacccc
cccatcttcaacccgaccacgtatcagggccgggtgcctgagaacaaggctaacgtcgaa
atcgctgtactcaaagtgacggatgccgatgtccccgataccccagcctggaaggctgtg
tacaccatactgaacaataacaatgatcaatttgttgtcaccacagacccagtaaccaac
gacggcattttgaaaacaactaagggcttggattttgaggacaagcagcagtatgtcttg
tacgtgaccgtggtgaatgtgatcccgtttgaggtcatcctctccacctccacagccact
gtcactgtggacgtggaggatgtgaatgaagcacccatcttcatcccttccccaaaggta
gtgtcaatccctgaagactttggtgtgggccaggaaatcacatcctacaccgccgaggat
ccagatacatatatggaacagaggataacgtatcggatttggagggatgctgccggttgg
ctggagattaatccagaatctggtgccattttcactcgggctgagctggacagagaggat
tttgagcacgtgaagaatagcacgtatgaagccctcattatagccattgacaacggttct
ccagttgctactggaacgggaactcttctactggtcctctctgatgtgaatgacaatggc
cccattccagaacctcgaaatatggacttctgccagaaaaacccacagcctcatgtcatc
aacatcattgatccagatcttccccccaacacatctcccttcacagcagaactaacacac
ggcgcaagtgtcaactggaccatcgagtacaatgacccagctcgtgaatctctaattttg
aagccaaagaaaactttagagttgggtgactacaaaataaatctcaagctcacagataac
cagaacaaggaccaggtgaccaccctagatgtgtttgtgtgcgactgcgaaggtgtcgtc
aacagctgcaagaggacggcgccttacgccgaagcaggcttgcaggttcctgccatcctg
ggcattctcggaggaatcctcgctctactaatcctgattctgctgcttctgctatttgtt
cggaggagaagggtggtcaaagagcccttacttcccccagaagatgacacccgggacaat
gtttattactatgatgaagaaggaggtggagaagaggatcaggactttgacttgagccag
ttgcacaggggcctggatgctcggcccgaagtgactcgtaatgatgtggccccaaccctc
ctgagtgtgccccagtatcggccccgccctgccaatcctgatgaaattggaaactttatt
gatgaaaacctgaaggcagcggacactgaccccactgctcctccttacgactctctgctc
gtgtttgactatgaaggaagcggttctgaagctgccagcctgagctccttgaactcctca
gagtcagaccaagaccaggactatgactacctgaatgaatggggcaatcgcttcaagaag
ctggcggacatgtatggaggtggcgaggacgactag

DBGET integrated database retrieval system