KEGG   Vulpes vulpes (red fox): 112924708
Entry
112924708         CDS       T05911                                 

Gene name
TP73
Definition
(RefSeq) tumor protein p73
  KO
K10148  tumor protein p73
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp04390  Hippo signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp05162  Measles
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112924708 (TP73)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112924708 (TP73)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112924708 (TP73)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    112924708 (TP73)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    112924708 (TP73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 112924708
NCBI-ProteinID: XP_025860926
UniProt: A0A3Q7SY82
LinkDB
Position
Unknown
AA seq 638 aa
MSQSTANDEGATFEHLWSSLEPDSTYFDLPQPNQGNSEVVGGAEAGMDVFHLQGMTTPVM
PQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPAIPSNTDYP
GPHHFDVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTVIRAMPVYK
KAEHVTEVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVMVPYEP
PQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDR
KADEDHYREQQALSESAAKNGAASKRAFKQSPPAVPALGANVKKRRHGDEDVYYMHVRGR
ENFEVLMKVKESLELMELVPQQLVDTYRQQQQQQLLQRPSHLQPASYGPVLSPMNKAHGG
VNKLPSVNQLVGQPPPHGSAAGPNLGPMGPGILNNHGHALPASSEMNGSHSAQSMVSGSH
CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQNIYHLQNLTIEDLGALKIPDQYRMT
IWRGLQDLKQSHDYGAQQLIRSSSNASTISIGSSGELQRQRVMEAVHFRVRHTITIPNRG
GPGGGSGPDEWADFGFDLPDCKSRKQSIKEEFTESEIN
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgtcccagtccaccgccaacgatgagggggccacgttcgagcacctctggagctccctg
gaaccagacagcacctactttgaccttccccagccaaaccagggaaacagtgaggtggtg
ggcggcgcagaggctggcatggatgtcttccacctgcagggcatgaccacgcctgtcatg
ccccagttcaatctgctgagcagcaccatggaccagatgagcagccgcgcggcctcggcc
agcccctacaccccggagcacgccgccagcgtgcccacccactcaccctacgcgcagccc
agctccaccttcgacaccatgtcgcctgcgccggccatcccctccaacaccgactaccct
ggtccccaccacttcgatgtcaccttccagcagtccagcacggccaagtcagccacctgg
acgtactccccactcttgaagaagctctactgccaaattgccaagacatgtcccatccag
atcaaggtgtccaccccgccgcccccgggcaccgtcatccgggccatgcccgtctacaag
aaggcggagcacgtgactgaggttgtgaaacgctgccccaaccatgagcttgggcgggac
ttcaacgaaggacagtctgctccggccagccacctcatccgggtggagggcaacaatctc
tcgcagtacgtggacgaccctgtcacgggcaggcagagtgtcatggttccctacgaacct
ccgcaggtggggacagaattcaccaccatcctgtacaacttcatgtgcaacagcagttgt
gtggggggcatgaaccggcggcccatcctcatcatcatcacactggagacccgggacgga
caggtgctgggccgccggtcctttgagggccgcatctgtgcctgtcctggccgagaccgc
aaagccgatgaagaccactaccgtgagcagcaggccctgagcgagagcgcagccaagaac
ggggccgccagcaagcgcgccttcaaacagagcccccctgccgtccctgccctgggtgcc
aatgtgaagaagagaaggcatggggacgaggacgtgtactacatgcacgtgcggggccga
gagaactttgaggtcctgatgaaggtcaaggagagcctggagctgatggagctggtgcca
cagcagctggtggacacgtaccggcagcagcagcagcagcagctcctgcaaaggccgagc
cacctgcagcccgcttcctatgggcccgtcctctcgcccatgaacaaagcacacgggggc
gtcaacaagctaccctctgtcaaccagctggtgggccagcctcccccacacggctcagca
gctgggcccaacctggggcccatgggccccggaattctcaacaaccacggccacgccctt
ccagccagcagcgagatgaatggcagccacagcgcccagtccatggtctcggggtcccac
tgcaccccaccacccccctaccacgccgaccccagcctggtcagtttcctgaccggactg
ggatgtccaaactgcatcgagtacttcacctcccagggcctgcagaacatttaccacctg
cagaacctgaccatagaggacctcggagccctgaagatcccggaccagtaccggatgacc
atctggaggggcctgcaggacctgaagcagagccacgactacggcgcccagcagctgatc
cgctccagcagcaacgcctccaccatctccatcggcagctccggggagctccagcggcag
cgggtcatggaggctgtgcacttccgcgtgcgccacaccatcaccatccccaaccgcggg
ggcccaggcgggggctcgggacctgatgagtgggccgactttggctttgacctcccagac
tgcaagtcccgaaaacagtccatcaaagaggagttcacggagagcgagattaactga

DBGET integrated database retrieval system