KEGG   Vulpes vulpes (red fox): 112924817
Entry
112924817         CDS       T05911                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04330  Notch signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112924817 (DVL2)
   04330 Notch signaling pathway
    112924817 (DVL2)
   04390 Hippo signaling pathway
    112924817 (DVL2)
   04150 mTOR signaling pathway
    112924817 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112924817 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112924817 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924817 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112924817 (DVL2)
   05226 Gastric cancer
    112924817 (DVL2)
   05217 Basal cell carcinoma
    112924817 (DVL2)
   05224 Breast cancer
    112924817 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112924817 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    112924817 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112924817 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112924817 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 112924817
NCBI-ProteinID: XP_025861132
UniProt: A0A3Q7TIH5
LinkDB
Position
Unknown
AA seq 736 aa
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSENSQPEMAPPAHEPRTELAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPG
GPSRLERHLAGYESSSTVMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERASSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPTYPGSSSMSTMTSGSSLPEGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPTPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEPGGAGDGGPPPSRGSSGGVPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcggcgcggggggcggcggcgtcggggagacgaaggtgatttaccacctg
gatgaggaggagactccctacctggtgaagatcccggtaccggccgagcgcatcaccctc
ggtgatttcaagagcgtcctgcagcggcccgcgggtgctaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaggagatttcagatgacaacgcccgccttccctgc
ttcaacgggagggtggtgtcctggctggtgtcatcagagaactcccaacccgaaatggct
cccccagcccacgagccccggacagagctagcaccgccccccccaccgctaccccccctg
ccaccggagaggaccagcggcatcggggattctaggcctccgtccttccaccctaatgta
tccagcagccgggagaacctggagcccgagacggaaaccgaatcggtggtgtccctgcgg
cgggaacggcctcgtaggagagacagcagtgagcacggtgcagggggccacaggcccggt
ggaccctcgaggctggagcgccacctggccgggtatgagagctcctcaactgttatgacc
agcgagctggagagcactagcctgggggactccgatgaggatgacaccatgagcagattc
agcagctccacggagcagagcagtgcctctcgcctcctcaagcgccaccggcggcggagg
aaacagcggccaccccgcctggagagggcgtcgtccttcagtagcgtcactgactccacc
atgtctctcaacatcatcacggttacactcaacatggagaagtacaacttcctgggcatc
tccatcgtgggccagagcaatgagcggggcgacggcggcatctacattggctccatcatg
aagggcggtgcggtggcagccgatgggcgcatcgagccgggtgacatgctgctgcaggtc
aatgacatgaattttgagaacatgagcaacgatgatgcagtgcgggtgctgcgggacatc
gtgcacaagccgggccccattgtgctaactgtggccaagtgctgggatccgtctccccag
gcctatttcactcttcctcgaaatgagccaatccagccgatcgacccagctgcctgggtg
tctcactcggctgcactgactggcacctttcccacctacccgggctcctcatccatgagc
accatgacatccgggtcttctctgcccgagggttgtgagggccggggtctgtccatccat
acggacatggcatctgtcaccaaggccatggcagctccagagtctggactggaagttcga
gaccgcatgtggctcaagatcaccatccctaacgccttcctgggctcggacgtggtcgac
tggctctaccatcacgtggagggctttcctgagcggcgggaggcccgcaaatatgccagc
gggctgctcaaggcgggcctcatccgccacactgtgaacaagatcacgttttctgagcag
tgctattacgtcttcggagacctcagtggcggctgtgagagctacctggtcaacctgtct
ctgaatgacaacgatggctccagtggggcttcagaccaggacaccttggctcctctgcct
ggggcgaccccatggcctctgctgcccaccttctcctaccagtacccaactccacaccca
tacagcccgcagccgcccccgtaccacgagctgtcatcctacacctatggtggcggcagt
gccagcagccagcacagcgaggggagccggagcagtgggtcaacacgaagcgatgggggg
gcaggccgtacagggaggcccgaggaacgggcccctgagtccaagtccggcagcggcagt
gagtctgagccctccagccgtgggggcagcctccggcggggcggggagccgggtggggct
ggtgatgggggccctcccccttccagaggctcgtcagggggtgtccccaatctccgagcc
caccctgggctccatccctatgggccacccccggggatggccctcccctataatcccatg
atggtggtcatgatgcccccccctccaccccctgtaccaccagcagtgcagcccccaggg
gcccctcctgtcagagacctgggctctgtgcccccagaactgacagctagccgacaaagc
ttccacatggccatgggcaaccccagtgagttctttgtggacgttatgtag

KEGG   Vulpes vulpes (red fox): 112926150
Entry
112926150         CDS       T05911                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04330  Notch signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112926150 (DVL1)
   04330 Notch signaling pathway
    112926150 (DVL1)
   04390 Hippo signaling pathway
    112926150 (DVL1)
   04150 mTOR signaling pathway
    112926150 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112926150 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112926150 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112926150 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112926150 (DVL1)
   05226 Gastric cancer
    112926150 (DVL1)
   05217 Basal cell carcinoma
    112926150 (DVL1)
   05224 Breast cancer
    112926150 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112926150 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    112926150 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112926150 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112926150 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 112926150
NCBI-ProteinID: XP_025862887
UniProt: A0A3Q7TNJ8
LinkDB
Position
Unknown
AA seq 700 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEISDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQSTDGHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSFIDSDEDDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDINFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKRGFL
RHTVNKITFSEQCYYVFGDLCSNLAALNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSARSAGGSSRRALGREKERRAAG
AGGSGSESDHTAPSGVGGSSWRERPASQLSRGSSPHSQASAAAPGLPPLYPLTKAYSVVG
GPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctatcacatggatgaggaggagacgccgtacctggtcaag
ctgcccgtggcgccggagcgcgtcacgctggccgacttcaagaatgtgctcagcaaccgg
ccggtgcacgcttacaaattcttcttcaagtccatggaccaggacttcggggtggtgaag
gaggagatctctgatgacaatgccaagctgccctgcttcaatggccgtgtggtctcctgg
ctggttttagccgagggcgcacactcagatgcaggatctcagagcactgatggtcacaca
gacttgcccccacctcttgagagaacgggcggcatcggggactcccggcccccctctttc
caccccaatgttgccagcagccgtgatgggatggacaacgagaccggcaccgagtcaatg
gtcagccaccggcgggagcgagcccgacgtcggaaccgcgaagaggctgcccggaccaac
ggacacccaaggggggaccggcggcgagatctggggctgccccctgacagtgcgtccacc
gtgctaagcagtgaacttgagtccagtagcttcattgactcggacgaggatgacaacaca
agccgactgagcagctccacggagcagagcacttcctcccggctcatccggaagcacaaa
cgccggcggcggaagcagcgcctgcggcaagcagaccgtgcctcttccttcagcagcatc
acggactccaccatgtccctgaacataatcaccgtcactcttaacatggagaggcaccac
ttcctgggcatcagcattgtgggtcagagcaacgagcggggtgatggtggcatctacatc
ggctccatcatgaagggcggtgctgtggcagccgatgggcgcatcgagccaggcgacatg
ttgctgcaggtgaacgacatcaacttcgagaacatgagcaatgacgacgcggtgcgggtg
ctgcgggagattgtgtcacagacggggcctatcagcctcacagtggccaaatgctgggac
ccgaccccccggagctacttcaccatcccgagggctgacccggtgcggcccatcgaccct
gctgcctggctgtcccacacggcggcactgacgggagccctgccccgctacggtacgagc
ccctgctccagcgctgtcacgcgcaccagctcctcctcactaaccagctctgtgcccggc
gctccacaactggaggaggcgcctctgacggtaaagagcgacatgggtgctgtggtgcgc
gtcatgcaactgccggactcgggcctggagatccgtgatcgcatgtggctcaagatcacc
attgccaatgccgtcattggggcggacgtggtggactggctgtacacacatgtggagggc
ttcaaggaaaggcgtgaggcccgcaagtacgccagcagcatgctgaagcgtggcttcctg
cggcacacagtgaacaagatcaccttctcggagcagtgctactacgtctttggggacctg
tgcagcaatctcgcagccctgaacctgaacagcggctccagtggggcttcggatcaggac
actctggccccactgccccatccggccgctccctggcccctgggtcagggctacccctac
cagtacccgggccccccgccctgcttcccacccgcctaccaggaccccggcttcagctac
ggcagcggcagtgctgggagtcagcagagtgaaggaagcaaaagcagcgggtctgcccgg
agtgctggcgggagcagccggcgggcactgggccgtgagaaggagcgccgggcggctgga
gccgggggcagtggcagcgagtcggaccacacggcaccgagtggggtcggtggcagcagc
tggcgggagcgtccggctagtcagctcagccggggcagcagcccacacagccaggcctcg
gctgctgccccggggctccctccactgtatcccttaacaaaggcatactcggtggtgggg
gggccacctggggggccacctgtccgggagctggcagctgttcccccagagctgacaggc
agccgccagtccttccaaaaggctatgggaaacccctgtgaattctttgttgacatcatg
tga

KEGG   Vulpes vulpes (red fox): 112926256
Entry
112926256         CDS       T05911                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04330  Notch signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112926256 (DVL3)
   04330 Notch signaling pathway
    112926256 (DVL3)
   04390 Hippo signaling pathway
    112926256 (DVL3)
   04150 mTOR signaling pathway
    112926256 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112926256 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112926256 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112926256 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112926256 (DVL3)
   05226 Gastric cancer
    112926256 (DVL3)
   05217 Basal cell carcinoma
    112926256 (DVL3)
   05224 Breast cancer
    112926256 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112926256 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    112926256 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112926256 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112926256 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 112926256
NCBI-ProteinID: XP_025863041
UniProt: A0A3Q7T494
LinkDB
Position
Unknown
AA seq 718 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEAAPFCADNPSDLPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTTRLNGTAKGDRRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSMASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPTKNFGLFDFL
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacgggcaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggccgactttaagggcgtcctgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaggagatt
tctgacgacaatgccaagttgccctgcttcaatggccgggtggtgtcttggttggtgtct
gctgagggctcacacccagaggcagctcctttctgtgctgacaacccatcagacctgcca
ccgcccatggagcgcacaggaggcattggggactcccggcccccatcattccaccctcat
gctggtggaggcagccaggagaacctggataatgacacagagacggactccttggtatct
gcccagcgtgagcggccacgcaggagggacggcccagagcacacaacccggctaaatgga
actgcaaagggggaccggcggcgagaaccagggggttatgatagctcatccacccttatg
agcagcgagttagagaccaccagcttctttgattcggatgaggatgactccaccagcagg
ttcagcagctccacagaacagagcagcgcctcacgcctgatgagaagacataagcggcga
cggaggaagcagaaggtttcacggattgagcggtcctcgtccttcagcagcatcacggac
tctaccatgtcactcaacatcatcacagtcactctcaacatggaaaagtacaactttctg
ggcatctctatcgtgggccaaagcaacgagcgtggtgacggaggcatctatatcggctct
atcatgaagggtggggctgtggctgcggatggacgcattgagccaggagatatgctgttg
caggtaaacgagatcaactttgagaacatgagtaatgacgacgcagtccgggtgctgcgg
gagattgtgcacaaaccggggcccatcaccctgactgtagccaagtgctgggacccaagt
ccacgtggttgcttcacactgcccaggagtgagcccatccggcccattgaccctgcagcc
tgggtctcccacactgcagccatgaccggcaccttccctgcctatggcatgagcccctcc
ctgagcaccatcacctccaccagctcttccatcaccagctccatccctgacacagagcgc
ctagacgacttccacctgtccatccacagtgacatggctgccattgtaaaagccatggcc
tcccctgaatctgggctggaggtccgtgaccgcatgtggctcaagattaccatccccaat
gctttcatcggctcggatgtggtggactggctataccacaacgtggaaggcttcactgac
cggcgagaggcccgcaagtatgccagcaacctgctaaaagccggcttcatccgccacact
gtcaacaagatcaccttctctgagcagtgctactacatcttcggtgacctctgtggcaac
atggccaacttgtccctccatgatcacgacggttccagcggagcctctgaccaggacact
ctggcccctttgccacaccctggggctgcgccgtggcccatggccttcccttaccagtac
ccgccacccccacacccctacaacccacacccaggcttcccagaactggggtacagctat
ggtgggggcagcgccagcagtcagcacagtgaaggcagccggagcagtggctccaaccgt
agcggcagtgaccggcggaaggagaaggacccgaaggcgggggactcgaagtcgggcggc
agcggcagcgagtcggaccacacaacccgcagcagcctgcgggggcctcgggaaagggca
cccagcgagcgctcgggccctgccgccagcgagcatagccaccgcagccaccactccatg
gccagcagcctgcgcagccaccacacgcacccgagctacggcccccctggcgtaccccct
ctctacggtcccccaatgctgatgatgcccccaccgcccgcggccatggggccccccgga
gccccaccgggccgcgacctggcctccgtgccccccgaactgaccgccagcagacagtcc
ttccgcatggccatgggaaaccccaccaagaatttcgggctgtttgactttctgtga

DBGET integrated database retrieval system