KEGG   Vulpes vulpes (red fox): 112924853
Entry
112924853         CDS       T05911                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04010  MAPK signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04137  Mitophagy - animal
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04216  Ferroptosis
vvp04218  Cellular senescence
vvp04310  Wnt signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp05012  Parkinson disease
vvp05014  Amyotrophic lateral sclerosis
vvp05016  Huntington disease
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112924853 (TP53)
   04310 Wnt signaling pathway
    112924853 (TP53)
   04071 Sphingolipid signaling pathway
    112924853 (TP53)
   04151 PI3K-Akt signaling pathway
    112924853 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112924853 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    112924853 (TP53)
   04210 Apoptosis
    112924853 (TP53)
   04216 Ferroptosis
    112924853 (TP53)
   04115 p53 signaling pathway
    112924853 (TP53)
   04218 Cellular senescence
    112924853 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112924853 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112924853 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    112924853 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924853 (TP53)
   05202 Transcriptional misregulation in cancer
    112924853 (TP53)
   05206 MicroRNAs in cancer
    112924853 (TP53)
   05205 Proteoglycans in cancer
    112924853 (TP53)
   05203 Viral carcinogenesis
    112924853 (TP53)
   05230 Central carbon metabolism in cancer
    112924853 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112924853 (TP53)
   05212 Pancreatic cancer
    112924853 (TP53)
   05225 Hepatocellular carcinoma
    112924853 (TP53)
   05226 Gastric cancer
    112924853 (TP53)
   05214 Glioma
    112924853 (TP53)
   05216 Thyroid cancer
    112924853 (TP53)
   05220 Chronic myeloid leukemia
    112924853 (TP53)
   05217 Basal cell carcinoma
    112924853 (TP53)
   05218 Melanoma
    112924853 (TP53)
   05219 Bladder cancer
    112924853 (TP53)
   05215 Prostate cancer
    112924853 (TP53)
   05213 Endometrial cancer
    112924853 (TP53)
   05224 Breast cancer
    112924853 (TP53)
   05222 Small cell lung cancer
    112924853 (TP53)
   05223 Non-small cell lung cancer
    112924853 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112924853 (TP53)
   05014 Amyotrophic lateral sclerosis
    112924853 (TP53)
   05016 Huntington disease
    112924853 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112924853 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112924853 (TP53)
   05161 Hepatitis B
    112924853 (TP53)
   05160 Hepatitis C
    112924853 (TP53)
   05162 Measles
    112924853 (TP53)
   05168 Herpes simplex virus 1 infection
    112924853 (TP53)
   05163 Human cytomegalovirus infection
    112924853 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112924853 (TP53)
   05169 Epstein-Barr virus infection
    112924853 (TP53)
   05165 Human papillomavirus infection
    112924853 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112924853 (TP53)
   01522 Endocrine resistance
    112924853 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112924853 (TP53)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112924853 (TP53)
   03400 DNA repair and recombination proteins [BR:vvp03400]
    112924853 (TP53)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    112924853 (TP53)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112924853 (TP53)
DNA repair and recombination proteins [BR:vvp03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112924853 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 112924853
NCBI-ProteinID: XP_025861192
UniProt: A0A3Q7TIN0
LinkDB
Position
Unknown
AA seq 381 aa
MQEPQSELNIDPPLSQETFSELWNLLPENNVLSSELCPAVDELLLPESVVNWLDEDSDDA
PRMPATSAPTAPGPAPSWPLSSFVPSPKTYPGTYGFRLGFLHSGTAKSVTWTYSPLLNKL
FCQLAKTCPVQLWVSSPPPPNTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQ
HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDYTTIHYNYMCNSSCMGGMNRRPIL
TIITLEDSSGNVLGRNSFEVRVCACPGRDRRTEEENFHKKGEPCPEPPPGSTKRALPPST
SSSPPQKKKPLDGEYFTLQIRGRERYEMFRNLNEALELKDAQSGKEPGGSRAHSSHLKAK
KGQSTSRHKKLMFKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcaagagccacagtcagagctcaatatcgacccccctctgagccaggagactttttca
gaattgtggaacctgcttcctgaaaacaatgttctgtcttctgagctgtgcccagcagtg
gatgagctgctgctcccagaaagcgtcgtgaactggctagacgaagactcagatgatgct
cccaggatgccagccacttctgcccccacagcccctggaccggccccctcctggccccta
tcatcctttgtcccttccccgaagacctaccctggcacctatgggttccgtttggggttc
ctgcattctgggacagccaagtctgttacttggacgtactcccctctcctcaacaagctg
ttttgccagctggcgaagacctgccccgtgcaactgtgggtcagctccccacccccaccc
aacacctgtgtccgcgctatggccatctataagaagtcggagttcgtgaccgaggttgtg
cggcgctgcccccaccatgaacgctgctctgacagtagtgacggtcttgcccctcctcag
catctcatccgagtggaaggaaatttgcgggccaagtacctggacgacagaaacactttt
cgacacagcgtggtggtgccttatgagccacccgaggttggctctgactataccaccatc
cactacaactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc
accatcatcaccctggaagactccagtggaaacgtgctgggacggaatagctttgaggta
cgcgtttgtgcctgtcccgggagagaccgccggactgaggaggagaatttccacaagaag
ggggagccttgtcctgagccaccccccgggagtaccaagcgagcactgcctcccagcacc
agctcctctcccccgcaaaagaagaagccactggatggagaatatttcacccttcagatc
cgggggcgtgaacgctatgagatgttcaggaatctgaatgaagccttggagctgaaggat
gcccagagtggaaaggagccggggggaagcagggctcactccagccacctgaaggcaaag
aaggggcaatctacctctcgccataaaaaactgatgttcaagagagaagggcccgactca
gactga

DBGET integrated database retrieval system