KEGG   Vulpes vulpes (red fox): 112924943
Entry
112924943         CDS       T05911                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04540  Gap junction
vvp04657  IL-17 signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp04912  GnRH signaling pathway
vvp04921  Oxytocin signaling pathway
vvp05206  MicroRNAs in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112924943 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112924943 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    112924943 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    112924943 (MAPK7)
   04921 Oxytocin signaling pathway
    112924943 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112924943 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112924943 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112924943 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112924943 (MAPK7)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112924943 (MAPK7)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112924943 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH Rrn6
Other DBs
NCBI-GeneID: 112924943
NCBI-ProteinID: XP_025861380
UniProt: A0A3Q7U147
LinkDB
Position
Unknown
AA seq 814 aa
MAEPLKEEEGDDGSGEPPGPVKAEPTNNAACVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQAVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPLPTSEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGTSGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPTAAPAPTPAPAPAPAHAPV
PAPTPAQPSSPPAAPPPKPAGSPTGPVPQPACQAPGPAPHPASPPGPVPGPAALQTATPS
LLAPPALVPPSGLPGPGAVAVLPYFPSGPPPPEPGGAPQPSTSESPDVNLVTQQLSKSQV
EDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWL
EGHGMNPADIESLQREIQMDSPMLLADLPDLQEP
NT seq 2445 nt   +upstreamnt  +downstreamnt
atggctgaacccctgaaggaggaagagggcgacgacggttctggggagccccccgggccg
gtgaaggcggaacccaccaacaacgctgcctgtgtagcggccaagaacctggccctgctc
aaagcccgctccttcgatgtgaccttcgacgtgggggacgagtacgagatcatcgagacc
ataggcaacggggcctatggggtggtgtcctccgcgcgccgccgtctcacgggccagcag
gtggccattaagaagatccctaatgcttttgacgtggtcaccaatgccaagcggaccctc
agggagctgaagatcctcaaacacttcaagcacgacaacatcatcgccatcaaggacatc
ttgaggcccactgtgccatatggggagttcaaatctgtctatgtggtcctggacctgatg
gagagtgacctgcaccagatcatccactcctcccagccactcactctggaacatgtgcgc
tacttcctgtatcagctgcttcggggcctcaagtacatgcactcggctcaggtcatccac
cgcgacctcaagccctccaacctgttggtgaatgagaattgtgagctcaagattggcgac
tttggcatggcccgtggcctgtgcacctcacctgctgaacaccagtacttcatgactgag
tatgtggccacacgctggtaccgtgctcctgagctcatgctctcactgcatgagtacacc
caggctatcgacctgtggtctgtgggctgcatctttggtgagatgctagcccggcgccag
ctcttcccaggcaaaaattatgtacaccagctgcagctgatcatgatggtgctgggtacc
ccatcaccagctgtaatccaggctgtgggggctgagagagtgcgggcctacatccagagc
ctgccaccacgtcaggctgtgccctgggagacagtgtatccaggggccgaccgccaagcc
ctgtcactgctgggacgcatgttgcgtttcgagcctagcgcccgcatctctgcagctgct
gcccttcgccaccccttcctggccaagtaccatgaccctgatgatgagcctgactgtgcc
ccaccttttgattttgcttttgaccgtgaagccctcactcgggagcgcattaaagaggct
atagtggcggagatcgaggacttccacgcacgacgtgagggcatccgccaacagatccgc
ttccagccttccctgcagcctgtggccagtgagcctggctgccctgatgttgagatgccc
agtccctgggctcccagcggggactgtgccatggagtcacctccaccggctccaccaccg
tgtcctggccctgcacctgacaccattgatctgaccctgcaaccacccctgccaaccagt
gaaccagcccctccgaagaaggagggtgccatctcagacaacaccaaggcagccctcaaa
gccgccctgctcaagtccttgcggagccggctccgagatggccccagtgctcctctggaa
gctcctgagcctcgaaagccggtgactgcccaggagcgtcagcgggagcgggaggagaaa
cggcggaggcggcaagagcgagccaaggagcgggagaagcggcggcaggagcgggaacgc
aaggagcggggggccgggacctctgggggtccctccaccgatcccctggctgggctggtg
ctcagtgacaatgaccgcagcctgctggagcgttggactcgcatggcccggcccgcagcc
cccacagcagccccagccccaaccccagccccagccccagccccagcccatgccccagtc
ccagcacccaccccagctcagcccagcagtcctcctgctgcccccccaccaaaacctgca
ggctcccccactggtcctgtaccgcagcctgcttgccaagcccctgggcctgctcctcac
cccgccagccctccagggcctgtccctggcccagctgcactccagactgccacccctagc
ctcttggctccccccgcacttgtgccaccctctgggctgcctggccccggtgccgtagct
gtgctgccttacttcccatctggcccgcctcctcccgagcccggaggggcccctcagccc
tccacctcagaatcccctgacgtcaacctggtcactcagcagctgtccaagtcacaggtg
gaggaccccttgcccccagtcttctcgggcactccaaagggcagtggggccggctatggt
gttggctttgacctggaggaattcctaaaccagtcttttgacatgggagtggctgacggg
ccacaggatggccaggcagactcagcctcactctcggcttccctgcttgctgactggctg
gagggccacggcatgaaccctgccgacattgagtccctgcagcgtgagatccagatggat
tccccgatgctgctggctgacctgccggacctccaggagccctga

DBGET integrated database retrieval system