KEGG   Vulpes vulpes (red fox): 112925532
Entry
112925532         CDS       T05911                                 

Gene name
IRS1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04022  cGMP-PKG signaling pathway
vvp04068  FoxO signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04722  Neurotrophin signaling pathway
vvp04910  Insulin signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04930  Type II diabetes mellitus
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp05010  Alzheimer disease
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112925532 (IRS1)
   04022 cGMP-PKG signaling pathway
    112925532 (IRS1)
   04151 PI3K-Akt signaling pathway
    112925532 (IRS1)
   04152 AMPK signaling pathway
    112925532 (IRS1)
   04150 mTOR signaling pathway
    112925532 (IRS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112925532 (IRS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112925532 (IRS1)
   04923 Regulation of lipolysis in adipocytes
    112925532 (IRS1)
   04920 Adipocytokine signaling pathway
    112925532 (IRS1)
   04935 Growth hormone synthesis, secretion and action
    112925532 (IRS1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112925532 (IRS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112925532 (IRS1)
  09149 Aging
   04211 Longevity regulating pathway
    112925532 (IRS1)
   04213 Longevity regulating pathway - multiple species
    112925532 (IRS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112925532 (IRS1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112925532 (IRS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112925532 (IRS1)
   04932 Non-alcoholic fatty liver disease
    112925532 (IRS1)
   04931 Insulin resistance
    112925532 (IRS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:vvp04990]
    112925532 (IRS1)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112925532 (IRS1)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 112925532
NCBI-ProteinID: XP_025862125
UniProt: A0A3Q7U4C2
LinkDB
Position
Unknown
AA seq 1239 aa
MASPPEADGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGASAPGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKQGSFRVRASSDGEGTMSRPASVDGSPVSPSTTRTHAHRHR
GSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGSSTLTAPN
GHYILPRGGNGHRYAPGAGLGTSPALAADEAAGAAELDNRFRKRTHSAGTSPTISHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHPLDRRGGHHR
PDAAALHTDDGYMPMSPGVAPVPSGRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGSCSPDIGGGPGSSSSGSAAPSGSSYGKLWTNGVGGHHPHALPHPKLPVESG
SGKLLSCAGDYMNMSPVGDSNTSSPSDGYYGPEDPQHKPVLSYYSLPRSFKHTQRPGELE
ESARHQHLRLSSSSGRLLYAATAEDSSSSTSSDSLGGGYCGVRPDPGLPHIHHQVLQPHL
PRKVDTAAQTNSRLARPTRLSLGDPKASTLPRVREQQHPPPLLHPPEPKSPGEYVNIEFG
SDQPGYLSGPVAARSSPSVRCPPQLQPAPREEETGTEEYMNMDLGPGRRAAWQEGAGVQP
GRVGPAPPGAASVCRPTRAVPSGRGDYMTMQVGCPGQGYVDTSPVAPISYADMRTGIVVE
EASLPGATAAAPSSSSAASASPTAPPKAGELVARSSLLGGPQGPGGMSAFTRVNLSPNRN
QSAKVIRADPQGCRRRHSSETFSSTPSATRAGNAVPFGGGAALGGSGGGSSAEDMKRHSS
ASFENVWLRPGELGGAPKEPAPHAGAAGGLENGLNYIDLDLVKDFKQRSQERPPQPQPPP
PPAPHQPLGSSESSSTSRSSEDLSAYASISFQKQPEDLQ
NT seq 3720 nt   +upstreamnt  +downstreamnt
atggcgagccccccggaggccgacggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaagcgcttcttcgtgctgcgggcggccagcgaggcggggggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgcttcaacatcaacaagcgggcggactccaagaac
aagcacctggtggccctttacacccgggacgagcactttgccatcgcggcggacagcgag
gcggagcaggacagctggtaccaggccctcctgcagctgcacaaccgggccaagggccac
cacgacggcgcctcggcccccggggcgggaggcggcgggggcagctgcagcggcagctcg
ggcctcggggaggccggcgaggacttgagctacggggacgtgcccccgggacctgcgttc
aaggaggtctggcaggtgatcctgaagcccaagggcctggggcagacaaagaacctgatt
ggcatctaccgcctctgcctgaccagcaagaccatcagcttcgtgaagctgaactccgag
gcggcggccgtggtgctgcagctgatgaacatccgacgttgcggccactcggagaacttc
ttcttcatcgaagtgggccggtccgcagtgacggggcccggcgagttctggatgcaggtg
gatgactccgtggtggcccagaacatgcacgagaccatcctggaggccatgcgggccatg
agcgacgagttccgccctcggagtaagagccagtcctcctccaactgctccaaccccatc
agcgtccccctgcgccggcaccacctcaacaacccccctcccagccaggtggggctgacg
cgccgctcgcgcaccgagagcatcaccgccacctctccggccagcatggtgggcggcaag
cagggctccttccgcgtgcgcgcgtccagcgatggcgagggcaccatgtcccgcccggcc
tcggtggacggcagccccgtgagcccgagcaccaccaggacccacgcgcaccggcaccgc
ggcagctcgcggctgcaccccccgctcaaccacagccgctccatccccatgccctcctct
cgctgctcgccttccgccaccagcccggtcagcctgtcgtccagcagcaccagcggccac
ggctccacctcggactgcctcttcccccggcgctctagcgcctcggtgtcgggttccccc
agcgacggtgggttcatctcctctgacgagtacggctccagcccctgcgatttccgaagt
tccttccgcagtgtcaccccggattccctgggccacacccccccggcccgcggcgaggag
gagctgagcaactacatctgcatgggaggcaaagggtcctccaccctcaccgcccccaac
ggtcactacattttgcctcggggtggcaatggccaccgctacgccccgggggctggcttg
ggcaccagcccggccctggctgcggatgaggcggccggtgcggccgagctggataaccgg
ttccgaaagcggactcactctgcgggcacgtcccccaccatttcccaccagaagaccccg
tcccagtcttccgtggcttccattgaggagtacacggagatgatgcctgcctacccgcca
ggaggtggcagtggaggccgactgcctggctaccggcactctgccttcgtgcccacccac
tcctaccccgaggaggggctggaaatgcaccccctggacaggcgtgggggccaccaccgg
ccggacgccgccgctctccacacggatgatggctacatgcccatgtccccgggagtggca
ccggtgcccagcggccggaagggcagtggggactatatgcccatgagccccaagagcgtg
tcggcgccgcagcagatcatcaaccctattagacgccatccccagagggtggaccccaat
ggctacatgatgatgtccccaagcggcagctgctctcctgacattggaggtgggcccggc
agcagcagcagcggcagcgccgccccttctgggagcagctatggcaagctgtggacaaac
ggggtagggggccaccaccctcacgccctgccgcaccccaaactccccgtggagagcggg
agtggcaagctcctgtcttgtgccggcgactacatgaacatgtcgccggtgggggactcc
aacaccagcagcccctccgacggctactacggcccagaggacccccagcacaagccagtt
ctctcctactactcattgccaaggtcctttaagcacacccagcgccctggggagctggag
gagagcgcccggcaccagcacctccgcctctcctccagctcgggtcgtctcctgtacgcc
gcgacggcggaagattcctcttcctccaccagcagcgacagcctgggcgggggatactgt
ggggtcaggccggatcccggcctcccgcatatccaccatcaggtcctgcagcctcacctg
cctcggaaggtggacacggcggcgcagaccaacagccgcctggctcggcccacgaggctg
tccctgggggaccccaaggccagcaccttaccacgggttcgagaacagcagcacccgccg
cccctgctgcaccctccggagcccaagagccccggggaatatgtgaatattgagttcggg
agcgatcagccgggctacttatcggggcccgtggccgcccgcagctcgccttctgtcagg
tgcccaccgcagctccagccagctccccgggaggaagagactggcaccgaggagtacatg
aacatggacctggggcctggccggagggcagcctggcaggagggtgctggggtccagcca
ggcagggtgggccccgcgccccccggggccgctagcgtgtgcaggcccacccgggcagtg
cccagcggccgcggcgactacatgaccatgcaggtgggctgccccggccagggctacgtg
gacacctcgccagtggcccccatcagctacgctgacatgcggacaggcattgtcgtggag
gaggccagcctgccgggggccacagcggccgccccctcctcgtcctcggcggcctcggct
tcccccacggcgcctccaaaagcgggggagctggtggcccgctcctccctgctggggggc
ccgcagggaccggggggcatgagcgccttcacccgggtgaacctcagtcccaaccgcaac
cagagtgccaaagtgatccgcgccgacccgcaggggtgccggaggcggcatagctctgag
accttctcctccacgcccagtgccacccgggcgggcaacgcagtgcccttcggcgggggg
gcggccctggggggcagcggtggcggcagcagcgcggaggatatgaaacgccacagttcg
gcttcctttgagaacgtgtggctgaggcctggggagctcgggggagcccccaaggagccg
gccccgcacgctggggccgccgggggtttggagaatgggcttaactacatagacctggat
ttggtcaaggacttcaaacagcgctctcaggagcgcccccctcaaccgcagccgcccccg
cccccggcccctcatcagcctctgggcagcagtgagagcagctcaaccagccgctccagc
gaggatctaagcgcctatgccagcatcagtttccagaagcagccagaggacctccagtag

DBGET integrated database retrieval system